KEGG   Providencia stuartii MRSN 2154: S70_09585
Entry
S70_09585         CDS       T02042                                 

Definition
(GenBank) phosphopeptide-binding protein
  KO
K11894  type VI secretion system protein ImpI
Organism
psi  Providencia stuartii MRSN 2154
Brite
KEGG Orthology (KO) [BR:psi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psi02044]
    S70_09585
Secretion system [BR:psi02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   S70_09585
SSDB
Motif
Pfam: FHA Yop-YscD_cpl DUF1494
Other DBs
NCBI-ProteinID: AFH93777
UniProt: A0A140NM71
Position
complement(2051547..2052818)
AA seq 423 aa
MDKYLPTISFRLINSELLESGYVSSMTFSQDGGQIGSSAQCQWQIQDNQNSVAPVQCTIL
WKDKHFCIKTNTESVYVNNAIVPLHLDAVRLAHGDQIKIGQLKLSVNVNLTGQPAEDLMA
VTPQSLVSSDSNPLDSLFNTTPTQSYEQEEYELAPTVQGSLTYDPLQALENESLSLISQK
NKQASDPLLMNEAHLTHSVTSPFSDNQGNTMVQEFMDLPKITPTLDDTITDIEHVAVNPL
MQGLGIHLNLQTSQQANDFLVELGKTIRSAIEGLLALQQQQESLQDKQLRPIEDNPLRLN
SSYEETMKLMFTDERSPVHLSAPSAVAESLHNIQLHYRANQEAISTALSTMLAAFSPEHL
LNRFAHYRRASDNSSTNDAWAWEMYTNYYKELSSSRQQGFEKLFYEVYTHAYDRALRKGL
EEA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggataagtatttaccgacaatttcatttcgcctgattaatagtgaattactcgaaagc
ggttatgtttcgagtatgacattttcacaagatggcgggcaaataggcagtagcgcacag
tgccagtggcagattcaagataaccaaaattccgtggcaccagtgcaatgcactattctt
tggaaggataagcacttttgcattaagaccaatacagaatcagtttatgtcaataatgcg
attgtacctcttcatcttgatgcggtacggcttgctcatggtgaccagatcaaaattggt
cagcttaaattgtctgttaatgtgaatcttactggacaaccagcagaagacttaatggct
gtcacccctcaatcactggtttctagcgatagtaatccattagattctctatttaatacc
acaccgactcaatcttatgagcaagaggagtatgagcttgctccgaccgttcaagggtcc
ctaacgtatgatccgcttcaagccttagaaaatgagagtcttagcttaatttctcagaaa
aataagcaagcttcagacccattattaatgaatgaagcacacttaacgcactcagtcacc
tccccattttcagataatcaagggaataccatggttcaggaatttatggatttaccaaaa
atcacaccaacacttgatgacactatcacagacattgagcatgtggctgtaaacccttta
atgcaagggcttggtattcatttaaatttacaaacttcacaacaagcgaacgattttcta
gtggagctagggaagactattcgctccgccatcgaaggtttattggcattacagcaacag
caagaaagcctgcaagataagcaacttagaccaattgaagataacccattgcgtttaaac
agcagttatgaagaaacaatgaagttgatgtttacggacgaacgtagtcccgttcattta
tcagccccttcagcggtagcagaaagtttgcataacattcagttgcattatcgagcaaac
caagaagctatttcgacggcactttcaacgatgttggctgctttctctcctgaacacctt
ttaaatcgtttcgcgcactatcgccgtgcttcagataactcttcgacaaacgatgcttgg
gcatgggaaatgtacaccaactactataaagagctgtcatcttctcgccagcaaggtttt
gaaaagttgttctatgaagtctatacccatgcctatgacagagccttaagaaaagggctt
gaggaagcataa

DBGET integrated database retrieval system