KEGG   Providencia stuartii MRSN 2154: S70_09600Help
Entry
S70_09600         CDS       T02042                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
psi  Providencia stuartii MRSN 2154
Brite
KEGG Orthology (KO) [BR:psi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psi02044]
    S70_09600
Secretion system [BR:psi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   S70_09600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AFH93780
UniProt: A0A140NM81
Position
complement(2055608..2056045)
Genome map
AA seq 145 aa AA seqDB search
MAANYNWDSSETASLFERIQGKSSGSSHHARMDALVRSIKNNLNQILNSRPDACQSSASL
GVPDLNDATQAATDFRRSLEHSITTCIQDFEPRISNVRVTFIENDADALLLQFSITAFID
LDSQRQLIEFNMQLDNNRRYQLKQF
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaactataactgggattcttcagagactgccagcttatttgaacgcatccaa
gggaagagctccggctcttcccatcatgctcgaatggatgccttagtgagatcaattaag
aacaatttaaatcaaatcctaaacagtcgaccagatgcttgtcaaagttcggctagccta
ggagtacctgatttaaatgatgcaacacaagcagcaacagattttaggcggagcctagaa
cattctattacaacctgcattcaagacttcgaacctcggatcagtaatgtccgagtgaca
tttatcgaaaatgatgcagatgccttgttgctccagttcagcatcaccgcttttatcgat
ctcgacagccagcggcagctcattgaatttaatatgcagctcgataacaaccggcgatat
cagttgaaacaattctaa

DBGET integrated database retrieval system