KEGG   Providencia stuartii MRSN 2154: S70_09610
Entry
S70_09610         CDS       T02042                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
psi  Providencia stuartii MRSN 2154
Brite
KEGG Orthology (KO) [BR:psi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psi02044]
    S70_09610
Secretion system [BR:psi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   S70_09610
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFH93782
UniProt: A0A140NPA3
Position
complement(2057549..2058046)
AA seq 165 aa
MSKKDLGSVAPKERINIKYTPNDGGAKSEIELPLNMLIVGDMIGRTEETPIEERKAISIN
QNNFNSVMESAGISLNINVENTLDEKSDSDLNVNLDIKSLQDFSPDNVARQVPELKKLLE
LREALVALKGPLGNIPAFRKRLQELLDNEETREQLLKELDIASQK
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagtaaaaaagatctcggtagtgttgcaccaaaagaaaggattaatatcaaatataca
cctaatgatggtggagctaaatctgaaatagaattgccgcttaatatgctaatcgtggga
gacatgattggtcgaacggaggaaactccgattgaagagcgtaaagctatttccattaac
cagaataactttaattcagtcatggaaagtgctggaataagcttaaatatcaatgtggaa
aatacacttgatgagaaaagtgattctgatcttaatgtgaatttagatattaaatccctt
caagatttttctcccgacaatgttgctcgccaagttccagaattgaaaaaattacttgaa
cttagagaggcattagtcgctttgaaaggtcctcttggcaatattcctgcttttagaaaa
cgtctgcaagagcttctagataatgaagagactcgcgaacagttgctgaaagaacttgat
attgctagccaaaaataa

DBGET integrated database retrieval system