KEGG   Providencia stuartii MRSN 2154: S70_09620Help
Entry
S70_09620         CDS       T02042                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00030  Pentose phosphate pathway
psi00480  Glutathione metabolism
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
psi01200  Carbon metabolism
Module
psi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
psi_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    S70_09620
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    S70_09620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psi04147]
    S70_09620
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     S70_09620
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     S70_09620
Exosome [BR:psi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   S70_09620
  Exosomal proteins of colorectal cancer cells
   S70_09620
  Exosomal proteins of bladder cancer cells
   S70_09620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AFH93784
UniProt: A0A140NJ48
Position
complement(2061492..2062934)
Genome map
AA seq 480 aa AA seqDB search
MSRFSLVILGASGDLTKRLLMPSLFRLHRLGLIPDLNIIGYSIDKWDHDSFLQHIHDALA
EFITDFNETEWKAFSEHLDFVSGSLEANDLKALESKLTPSALFYLALPPTLFGQAAQAIG
EAGLSKESGDNWRRILIEKPFGTDLESAEVLRGQVHAYWDESQVYRIDHFLGKEATQNLM
IFRFANRVLAPVWNAEHIEQVQITYAETLGVENRAVYYDHSGAMRDMLQNHLMQLLTLTA
IEPLGRWDGEILRDHKVEVLKSIRPTDDMDANDWAVRGQYCAGQVNGETATDYCNEPGIP
VDTNTETFAALRIEIDNWRWKGVPFYLRSGKRLANNYAEIAVQFKAPAGALPGDIQVDNN
WLVFRLSPTMGMDMHMTAKLPGMNLNTHGIVLSAPYTLPGQYEVSAYEQLLIDALHGERA
HFLRFDEVEWAWRVIDPALKAWQKGMPDLYKAGTEGPDTQSRIMRPGHQWRSLFEQEGRE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtttctctttggtgatcttgggggcaagcggtgatttaactaaacgtctattg
atgccttctctatttcgtttacatcgattaggactgatccctgatttgaacattatcggg
tattcgattgataaatgggatcatgactcgtttttgcaacatatccatgatgcattggcg
gagtttattactgattttaatgaaacagaatggaaagcgtttagcgaacatttggatttc
gtcagtggctcattagaagcgaatgatttgaaggcgttggaaagtaaactaacgccatct
gcactcttttatttagccttaccaccgaccttatttgggcaagcggctcaggcgataggc
gaagcggggctatctaaagaaagtggtgataattggcgacgtattttaattgaaaaaccg
tttggtactgatcttgaatcggcagaggtattgcgcgggcaagtacatgcttattgggat
gaatcacaagtttaccgtattgatcatttcttaggaaaagaggcaacacaaaacttgatg
attttccgttttgctaaccgcgtcctcgccccggtttggaatgctgagcatattgagcag
gtgcaaattacttatgcagaaacattaggtgtagaaaaccgagctgtctattacgaccac
tctggtgcgatgcgtgacatgctgcaaaaccatcttatgcaattgctgacattaacggca
attgagccattagggcgctgggatggtgagattctacgtgatcataaagtggaagtgttg
aaatccattcgaccaacagatgatatggatgccaatgactgggccgttcgtgggcagtat
tgtgcagggcaagtgaatggcgaaactgcgacggattactgcaacgagccaggtatccct
gtcgataccaacacagaaacgtttgccgcattgcgaatagagatagataactggcgctgg
aaaggtgtgcctttctatttacgaagtggtaaacggttagccaataattacgctgaaatc
gctgtgcaatttaaagctccggccggtgcattaccgggggatattcaggtcgataataat
tggctcgtctttagattatccccaacgatggggatggatatgcatatgacggcgaagttg
ccagggatgaatttaaatacgcatggcatcgtgctcagcgcgccttataccttaccgggg
cagtatgaagtttcggcttacgagcaacttttaattgatgcactgcatggtgagcgtgcg
catttcctccgctttgatgaagtcgaatgggcatggcgggtcatcgaccctgcgctaaaa
gcgtggcagaagggaatgcctgacctgtataaggcgggaacggaagggccagatacgcaa
tctcggatcatgcgccccggtcatcaatggcgttcactgtttgaacaggagggtcgcgaa
tga

DBGET integrated database retrieval system