KEGG   Providencia stuartii MRSN 2154: S70_10745Help
Entry
S70_10745         CDS       T02042                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00770  Pantothenate and CoA biosynthesis
psi01100  Metabolic pathways
Module
psi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    S70_10745
Enzymes [BR:psi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     S70_10745
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     S70_10745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N
Motif
Other DBs
NCBI-ProteinID: AFH94002
UniProt: A0A140NPX7
Position
complement(2307532..2308737)
Genome map
AA seq 401 aa AA seqDB search
MTQLLGKKIVLGISGGIAAYKIPELTRRLRDEGAIVRVVMTHGAKAFITPLTLQAVSGHP
VSDDLLDPAAEAAMGHIELAKWADIIILAPATADLIARVTSGMANDLLTTICLASAAPIA
VVPAMNQQMYRATATQENLIKLKQRQYIIWGPDNGSQACGDVGPGRMIDPLEIVRLTCEH
FRSRTDLQGVKIMITAGPTREDLDPVRFISNHSSGKMGFAIAEAASQRGAQVTLIAGPVN
LATPSGVTRVDVISALDMYEQVHHTIAQQDIFIGCAAVADYRAKTIAENKIKKQGDEVAI
TLVKNPDIVASVGQLTQNRPYVVGFAAETQNVEEYARQKRQQKQLDLICANDVSLADNGF
NSDNNALHLFDSFGDVRLPHSSKLELSHRLLDEILQRYEKN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacacagctattaggtaaaaaaatagttctcggcattagtggtggtattgccgcgtat
aaaattcctgaactaacccgtcggttacgtgatgaaggcgcaatagttcgtgttgttatg
acccatggtgcaaaagcctttataacccctttgacgctacaagcggtttccggtcatcct
gtctctgatgatttacttgatcccgctgctgaggccgcaatgggccatattgaattggcc
aaatgggcagatatcatcatattagcgccggctaccgcagatttaattgctcgggtcact
tcaggtatggctaatgacctactcacgacaatttgtttagcttcggcagcccccattgct
gttgtacctgccatgaaccaacaaatgtatcgggcaaccgcaacacaagaaaatttaatt
aaactgaaacaacgtcaatatattatctggggtccagataatggtagccaagcctgtggc
gacgttgggccgggtcgaatgatagacccactcgagatagtacgcctaacctgcgagcat
ttccgctctcgaacagacttacaaggtgtaaaaatcatgattactgctgggcctactcgt
gaagacttagatcccgtccgttttatcagtaatcacagttctgggaaaatgggttttgca
atcgccgaagcggcaagccaacgcggggcacaagtcactttaatcgctggcccagtgaat
ttagcaacgccctccggagtcacacgggttgatgttatcagcgctctcgatatgtatgag
caagtccaccacactattgcacaacaggatatctttattggttgtgctgccgttgctgat
tatcgtgcaaaaaccatcgcagaaaataaaatcaaaaagcaaggtgatgaagttgccatt
acattagttaaaaacccagatattgttgcgagtgttggtcagttaacgcaaaatcgccct
tatgtggttgggtttgcagccgaaacccaaaatgtggaagaatacgcacgccaaaagcgc
caacaaaaacagttggatctaatttgcgcgaatgatgtttctctcgctgataatggtttt
aacagtgataataatgcgttacatcttttcgattcctttggtgatgtccgtttaccacac
agtagtaaacttgaattaagccaccgtttattagacgagatacttcaacgttatgaaaaa
aattga

DBGET integrated database retrieval system