KEGG   Providencia stuartii MRSN 2154: S70_12455Help
Entry
S70_12455         CDS       T02042                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00230  Purine metabolism
psi00240  Pyrimidine metabolism
psi01100  Metabolic pathways
psi03030  DNA replication
psi03430  Mismatch repair
psi03440  Homologous recombination
Module
psi_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    S70_12455
   00240 Pyrimidine metabolism
    S70_12455
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    S70_12455
   03430 Mismatch repair
    S70_12455
   03440 Homologous recombination
    S70_12455
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     S70_12455
DNA replication proteins [BR:psi03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     S70_12455
DNA repair and recombination proteins [BR:psi03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     S70_12455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AFH94338
UniProt: A0A140NNW4
Position
complement(2676761..2677210)
Genome map
AA seq 149 aa AA seqDB search
MKNATFYLLEQPSPQVELEAHEWLACELAAQMWRDGKRVLVACETAEQAEKLDESLWQRD
PHQFVPHNLAGEGPRYGAPIEICWPGKRGNAQRDILINLQSQFADFATAFHEVIDFVPID
ETLKQLARERYKIYRSVGFNLTMATPPTN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgccaccttttatttgcttgaacaaccatcgccgcaagtggagttagaagcc
catgaatggcttgcttgcgaacttgcggcgcaaatgtggcgtgatggtaagcgtgtttta
gtcgcgtgtgaaaccgctgagcaagcagaaaaactggatgagtcactttggcaaagagat
cctcatcagttcgtgcctcataaccttgctggtgaagggcctcgttatggcgcaccgatt
gaaatttgctggccggggaaacgtggaaatgcccaacgcgatattctgatcaatcttcag
agccagtttgcagactttgccactgcattccatgaagtgatagactttgtgcctattgat
gaaactttaaaacagttggcgcgtgaacggtataaaatttaccgcagcgtcggcttcaat
ttgactatggcgacgccgccaactaactga

DBGET integrated database retrieval system