KEGG   Providencia stuartii MRSN 2154: S70_14750
Entry
S70_14750         CDS       T02042                                 

Definition
(GenBank) Rhs family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    S70_14750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psi02044]
    S70_14750
Secretion system [BR:psi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   S70_14750
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C Acetone_carb_G
Other DBs
NCBI-ProteinID: AFH94777
UniProt: A0A140NQ19
Position
complement(3128043..3130199)
AA seq 718 aa
MFSKDPKKSSPDLASMLKDEAINQAKEAAMSKASARTQQAVNLAQQAASAASSLQASAAM
LTPGGGLTGGLNPADPDTAQAALRSALGLTAEPSGLVFTCEIGLFPAGTFQVTDFTLTEG
LSSLYHLSLNVVSLLPYIEFQTHLGQAASLTVKRDGQIVRTVNGILAGGVQGNTDGVKTW
YHFDIRPEMWIMTLNQDSRIFQDQNAPAILKTLLDEAHVKSDCLFYREALHPERTYTTQK
RESTYDFWCRLAFEEGINFWFEEDQMFYSDEHMGMTAGISLTYNPQANTDITDSTATTWQ
YGEYLCPDQLIQKDNNYVRPSYPLMHQDQQAGGGQHSVFESYGRFQLDAEGEPLTKARFE
QLRSGSRVGNATTNCFALRPGKIFTLQNHPHAPMNDSWQVITVTHHGVQPLADNGGGEGT
QLSNTVSFIPGREEWRPPHRYKPTADGDELATVVGPPGEEIYVNEYGAVKVHFHWDRYGK
PDHSASCWVRVAMGWSGNGYGFSAVPRIGTVVQVSYLNGDIDRPIITGCTYDGRNAPPIR
FPENKTRTTFRTQTHKGEGFNELRFEDEDGKQEVFIHAQKDMNTVVRDNRSTTVGANHKE
VILQNQTVSVHGSQSTSVQSDQKNVVFGNQQSIVDGEVVIASAKGIRLISGTSVLQLSPS
GRVTIACENFDFYASGSGQIATGEILDLNMDNAAPGITKIDPNTDTIASTKSQFFPEK
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgttctcaaaagatccgaaaaaatcatcccctgatctggcgtcgatgctgaaggacgaa
gccattaaccaagccaaggaagcggcgatgtcaaaggcatctgcgcgaacacaacaagcc
gtcaatttggcccaacaagcggccagtgcggcgtcctcgttgcaggcctccgccgcgatg
ttgacccccggcggcgggctaacgggggggctcaaccctgccgatccggataccgcgcaa
gcggccttacgcagcgcgttagggttaaccgccgagccgagcggtttagtgtttacctgt
gaaatcggcttatttcctgcgggcacctttcaagtcaccgattttaccctcaccgaaggg
ctctcttccttatatcaccttagcctgaatgtggtgagtttgttgccttatattgaattc
caaacgcatttaggccaagccgcctcactgacggtcaaacgggatgggcagattgtgcgc
accgtcaatggcattcttgcgggcggtgtccaaggcaataccgatggcgtgaaaacgtgg
taccattttgatatccgccctgaaatgtggatcatgaccctcaatcaggacagccgtatc
ttccaagaccaaaacgcccccgcgattttaaagacgttattggatgaagcgcacgtcaaa
tcagactgtcttttttaccgtgaagcgctgcatccggaacggacctacaccacgcaaaaa
cgggaatccacctatgacttttggtgtcgcttagcctttgaggaagggatcaacttctgg
tttgaagaagatcagatgttctacagtgatgagcacatgggcatgaccgcggggatctcg
ttgacttacaacccgcaagcgaacaccgatatcaccgacagtaccgccaccacctggcag
tacggagagtatctgtgccccgatcaactgatccaaaaagacaacaactacgtgcgcccc
tcttacccgctgatgcaccaagatcagcaagcaggcggtgggcagcacagtgtgtttgaa
agttacgggcgttttcaattggatgccgaaggggagcccctgaccaaagcccgttttgag
cagttacgcagcggcagccgcgtgggcaatgccaccacgaactgctttgccttgcgccca
ggcaaaattttcaccctgcaaaatcacccacacgccccgatgaatgacagttggcaagtc
atcacggtcacccatcacggcgtgcaacccttagccgacaatggcgggggcgaaggaacg
caattaagtaacacggtctcctttataccgggtcgtgaggagtggcgtccgccacaccgt
tataaaccgacggccgatggggatgaattggcgaccgtggtggggccgccgggggaagag
atttacgtcaatgagtacggcgccgtcaaagtgcatttccattgggatcgctacggcaag
cccgatcacagcgcttcctgttgggtgcgtgtcgccatgggatggagcggcaacggttac
gggttttcggccgtgccccgtatcggcactgttgtgcaagtcagttacctgaacggggat
attgaccgccccattatcacgggatgcacttacgatggccgcaatgctccccctattcgt
tttcctgagaacaaaacacgcaccacgttccgcactcaaacccataagggcgagggcttt
aacgagttacgttttgaggatgaggacggtaagcaggaagtgtttattcatgcgcaaaaa
gacatgaatacggtagtacgggataatcgttcgacgaccgtgggggccaaccacaaagaa
gtcatcctacaaaaccaaacggtttcagtgcatggctctcaatcgacctcagtacagtct
gaccaaaagaatgtcgtctttgggaatcaacagtctattgtcgatggtgaagtggtcatc
gcttccgcaaaagggatccgtcttatcagcggtacgtccgttcttcaattgagtccctcg
gggagggtcaccatcgcgtgtgaaaattttgatttttatgccagtggttcagggcaaatt
gccacgggtgagatcctcgatctcaatatggacaatgccgcgccagggatcactaaaata
gatccgaataccgacaccattgccagcacaaaatcccaattttttcctgaaaaataa

DBGET integrated database retrieval system