KEGG   Providencia stuartii MRSN 2154: S70_14780Help
Entry
S70_14780         CDS       T02042                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
psi  Providencia stuartii MRSN 2154
Brite
KEGG Orthology (KO) [BR:psi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    S70_14780 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AFH94783
UniProt: A0A140NPJ0
Position
complement(3134974..3135351)
Genome map
AA seq 125 aa AA seqDB search
MLNEPNVSIQVQSVYIVSQSQPEIGRYVFAYTISIRNLGREPLQLMSRYWLITNSDGHKT
EVQGEGVVGEQPIIQPGAVYRYTSGAILETPMGTMEGYYVMLNSRGEHIHVDIPPFRLAL
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacgaacctaatgttagcatccaagtacagagtgtctatatcgtcagccagtct
caacctgaaataggacgatatgtatttgcctataccatatctatccgtaacttaggccga
gagccactacaattaatgagccgctattggctcattactaacagtgatggtcataaaact
gaagttcaaggcgaaggcgttgtcggtgaacaaccaatcatccagcccggtgcggtatat
cgttataccagtggagcaatattagaaactcccatgggtacaatggaaggttattacgtc
atgttaaacagccgaggagaacacattcatgtggatattcctccattccgccttgcttta
cctactttgattaattaa

DBGET integrated database retrieval system