KEGG   Providencia stuartii MRSN 2154: S70_19365Help
Entry
S70_19365         CDS       T02042                                 

Definition
(GenBank) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00520  Amino sugar and nucleotide sugar metabolism
psi01100  Metabolic pathways
psi01503  Cationic antimicrobial peptide (CAMP) resistance
Module
psi_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    S70_19365
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    S70_19365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psi01005]
    S70_19365
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     S70_19365
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     S70_19365
Lipopolysaccharide biosynthesis proteins [BR:psi01005]
 Unusual sugar
  S70_19365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 Sacchrp_dh_NADP TrkA_N NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AFH95669
UniProt: A0A140NQA5
Position
4044085..4046067
Genome map
AA seq 660 aa AA seqDB search
MKAIVFAYHDIGCVGLKALKKAGFDIQAVFTHTDDPNENHFFSSVARVSADMELPVYAPE
NVNHPLWIERIRELKPDVIFSFYYRDMLSEELLALAPKGAFNLHGSLLPKYRGRAPINWA
LLNGEKETGVTLHKMVTKADAGDIVAQEKVTITDTDTALTLHAKVREAAEVLLDKTLPLI
EAGSYKTVAQDESQASYFGRRTAQDGLIDWNRSAKEIDCLIRAVTEPYPGAFTYLGERKM
VIWRARVLDDNQGKRAGTVLSSDPLRIACGEGAIEVVSGQGDSGLYMQGNRLANEMGIVT
DVRVGPKPTAQIKRRKRVLILGVNGFIGNHLTERLLQDDNYDIYGMDISSSAIDRFIGNP
RFHFIEGDVSIHTEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLKIVRYC
VKYNKRIIFPSTSEVYGMCDDKEFDEDESRLIVGPINKQRWIYSVSKQLLDRVIWAYGAK
EGLKFTLFRPFNWMGPRLDSLNSARIGSSRAITQLILNLVEGSPIKLVDGGEQKRCFTDI
KDGIEALFRIIENKDGKCDGQIINIGNPTNEASIRQLAEMLLESFEKHPLRGHFPPFAGF
REIESSSYYGKGYQDVEHRKPSVENARRLLDWVPTIDMKDTIEETLDFFLQGAVEELGKN
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctattgtttttgcctatcatgatattggctgtgtagggctgaaagcgctaaaa
aaagcaggtttcgatattcaagcagtatttactcatactgatgatcctaacgaaaaccac
tttttctcttcagtagcgcgtgtcagcgcggacatggaacttcctgtttacgcgccagaa
aacgtaaaccatccgctatggattgaacgtattcgcgaattaaaacctgatgtaattttc
tcattctattaccgcgatatgctcagtgaagaactgctggcattggcccctaaaggtgca
tttaacctgcatggctctttactgcctaaataccgcggtcgtgcaccaattaactgggca
ttgctgaacggcgagaaagaaacaggcgtgacgttgcacaaaatggtcactaaagccgac
gcgggtgacattgttgcacaagaaaaagtcacaatcaccgatactgatactgcattaacg
ttacacgcaaaagttcgtgaagcggctgaagtactgttagataaaacactgccattgatt
gaagcgggtagctataaaacagtggcgcaagatgagagccaagcaagctatttcggtcgt
cgtaccgctcaagatggcttgatcgactggaaccgttctgcaaaagaaattgattgctta
attcgtgctgttactgagccatacccaggcgcatttacctatttaggtgagcgtaaaatg
gtaatttggcgtgcacgtgtgctcgatgataatcaaggtaaacgcgcgggtacagtatta
tcaagtgaccctctgcgtattgcttgtggcgaaggggctattgaagttgttagtggtcag
ggtgactccggtttatatatgcaaggcaaccgtctagcaaatgaaatgggtatcgtgact
gatgttcgtgtagggccaaaaccgactgcacaaattaaacgtcgtaagcgtgttctgatc
ttaggtgttaacggttttatcggtaaccatttaacagagcgtttattgcaagatgataat
tatgatatctatggtatggatatcagctcatcggcgattgaccgctttattggtaaccca
cgtttccactttatcgaaggtgacgtcagtattcataccgaatggatcgaataccacatt
aagaaatgtgacgttattctgccattggtggcgattgcaacaccaatcgaatatacccgt
aacccactgcgtgtctttgaattagactttgaagaaaacctgaaaatcgtgcgttactgc
gtgaaatataacaaacgtattatcttcccatcgacttctgaagtttatgggatgtgtgat
gataaagagtttgatgaagatgagtcacgtttgattgttggtcctatcaataaacagcgc
tggatctactctgtgtctaaacagctgttagaccgagtgatttgggcatatggcgcgaaa
gaaggcttgaaatttacgttattccgtccgtttaactggatggggccacgtttggatagc
ctgaactcagcacgtattggtagctctcgtgcgatcactcagttaatcttgaatttagtt
gaaggttcgccaattaaattggttgatggtggtgagcaaaaacgctgtttcactgatatt
aaagatggtatcgaagcactgttccgtattattgaaaacaaagacggcaaatgcgacggt
cagatcatcaatatcggtaacccaacaaacgaagcaagcattcgccaattagctgaaatg
ttacttgaaagtttcgaaaaacaccctctacgcggccatttccctccgtttgcaggtttc
cgtgaaatcgaaagtagcagctactatggtaaaggttatcaagatgttgaacaccgtaaa
ccaagcgtggaaaatgcacgtcgtctgcttgattgggttccaacaatcgatatgaaagat
actattgaagagacactggatttcttcttgcaaggtgcggtagaagaattaggtaagaac
taa

DBGET integrated database retrieval system