KEGG   Providencia stuartii MRSN 2154: S70_21000Help
Entry
S70_21000         CDS       T02042                                 

Definition
(GenBank) beta-eliminating lyase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00260  Glycine, serine and threonine metabolism
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
psi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S70_21000
Enzymes [BR:psi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     S70_21000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AFH95979
UniProt: A0A140NR71
Position
4377157..4378182
Genome map
AA seq 341 aa AA seqDB search
MYSFQNDYNEIAHPAVMKALNDLVGSRFDGYGIDKYTQQIAEKIKSRIGRTDADIHFFNG
GTITNLTAISHVLRPHQAVIAVDSGHIATHETGAIEATGHKVLTVSSDSGKLEPKHIQAV
LAEHSDEHAVQPKLVYISNSTEIGTVYRKHELQALREACDQYGLWLFMDGARLASGLMSN
KSDLTIEEIAQMTDMFYIGGTKIGAFSAEVLVLLNPALKSDFRYTLKQKGALQAKGWLLA
AQFDALFSDDLFFQLGAYVNDKATQLVNLFEEKGFGFLAPPESNQIFVVLPNELATKLMS
HYVLRKICEPEAGKSCLRLCTSWSTTQEDVDRFISTFNSLI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtacagttttcaaaatgattataatgaaatagcacaccccgcagtcatgaaagcgcta
aatgatttagttggaagccgttttgatggttatggaatagataaatatactcaacaaatt
gcggagaaaattaagtctagaatagggcgtacagacgcagatattcacttttttaatggt
ggtacgatcaccaatttaacagccatttcccatgttttgcgtccacatcaagccgtaatt
gccgtcgattctgggcatattgcgacccatgaaacaggggctattgaagcaacaggccat
aaggtcctcaccgttagctcagactccggtaaacttgaaccaaagcatattcaggcggta
cttgccgagcatagtgatgagcatgcagtacaacccaaattagtctatatcagtaactca
acagaaataggtactgtatatcgtaaacatgaacttcaggctctaagggaggcctgtgat
caatatggtttgtggctatttatggatggggcgcgtttagcatctggattaatgtcgaac
aagagtgatttaacaatcgaagaaatcgctcaaatgacggatatgttctatatcggtgga
acaaaaataggcgctttttcagcagaagtattggtgcttttaaatcctgcacttaagtct
gatttccgctataccctaaaacaaaaaggcgctttgcaagcaaagggttggttgttggcg
gcacaatttgatgcactgtttagcgatgacctattttttcaattgggggcatatgttaat
gataaagcgacacagctagtgaacctttttgaggaaaaaggttttggtttccttgcacca
ccagaatctaatcaaatttttgtggttttacctaacgaacttgcgactaaattgatgtct
cattacgtattgcgtaagatttgtgagcctgaggcagggaaaagctgtttgcgcctttgt
acttcctggtcaacaactcaggaagatgttgatagatttatttcaacatttaactcatta
atttaa

DBGET integrated database retrieval system