KEGG   Pseudomonas silesiensis: PMA3_00795Help
Entry
PMA3_00795        CDS       T05412                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
psil  Pseudomonas silesiensis
Pathway
psil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psil00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PMA3_00795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psil02022]
    PMA3_00795
Two-component system [BR:psil02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PMA3_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ANJ53760
UniProt: A0A191YLK2
Position
173481..174221
Genome map
AA seq 246 aa AA seqDB search
MSSTANIAEGEKILIVDDDPGLSSLLERFFVSKGYRARAVPNTEQMDRLLAREVFNLVVL
DLMLPGEDGLTACRRLRGANNQIPIIMLTAKGDELSRIKGLELGADDYLAKPFNPDELMA
RVKAVLRRQAAPVPGAPGSEDESVTFGDYELSLATRELKRGDEVHMLTTGEFAVLKALVM
NARQPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDPSKPRYIQTVWGVGYVFVP
DGAATK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactgcaaacattgctgaaggcgaaaaaattcttatcgttgacgacgatccg
gggctcagcagcctgctggaacgctttttcgtcagcaagggctaccgcgcccgcgccgtt
ccgaacaccgaacaaatggaccgcctgctggcacgtgaagtgttcaacctggtcgtcctc
gacctgatgctgcccggcgaagacggcttgaccgcctgccgccgcctgcgcggcgcgaac
aatcagattccgatcatcatgctcaccgccaagggcgatgagctgagccgcatcaagggc
ctcgagctgggtgccgacgattacctggccaagccgttcaacccggacgagctgatggcg
cgggtcaaagcggtcctgcgccgtcaggcagcgccggtgccgggcgcaccgggcagcgaa
gacgaaagcgtgacctttggtgactacgagctgtccctggcgacccgcgaactcaagcgc
ggcgacgaagtgcacatgctcaccaccggtgagttcgccgtgctcaaggcgctggtgatg
aacgctcgtcagccgctgacccgcgataaactgatgaacctggcccgtggtcgcgagtgg
gatgcgctggagcgctccatcgacgtgcagatttcccgcctgcgccggatgatcgagcct
gatccatccaagccacgctacatccagacggtttggggcgtgggttacgtattcgttccg
gatggcgctgccaccaagtga

DBGET integrated database retrieval system