KEGG   Pseudomonas silesiensis: PMA3_05660Help
Entry
PMA3_05660        CDS       T05412                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psil  Pseudomonas silesiensis
Pathway
psil00260  Glycine, serine and threonine metabolism
psil01100  Metabolic pathways
psil01110  Biosynthesis of secondary metabolites
psil01120  Microbial metabolism in diverse environments
psil01130  Biosynthesis of antibiotics
psil01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMA3_05660
Enzymes [BR:psil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PMA3_05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 DUF4031 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ANJ54684
UniProt: A0A191YPI5
Position
1263840..1264844
Genome map
AA seq 334 aa AA seqDB search
MSVIDLRSDTVTQPTAGMLHAMATAATGDDVYGEDPTVNRLETELAKRLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPLEVRADGSLDLSQVAA
AIKPDDFHFARTRLLALENTMQGKVLPLEYLARARTFTQEQGLALHLDGARLYNAAVKLG
VDAREITRHFDSVSVCLSKGLGAPVGSVLCGTVELIDKARRLRKMVGGGMRQAGILAAAG
LYALDHNVQRLADDHANAQILADGLRKAGYDVEPVHTNMVYVQMGDKAEAIKAFAAERGI
KLSAAGRLRMVTHMDVSRVQIGQVVAAFVEFSRN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttatcgatcttcgcagcgacactgtcacccaaccgaccgccggaatgctccac
gcaatggccaccgcggccaccggtgacgacgtttacggcgaagatccgacggtcaatcgt
ctggaaaccgagctggcaaaacggctgggtttcgctgccgcgctgttcgtgccgacgggc
accatgagcaacctgctgggcttgatggcgcactgcgagcgcggtgacgaatacattgtc
ggccagcaagcgcacacctataaatacgaaggtggcggtgcggcggtgctggggtcgatc
cagccgcaacctctggaagtgcgggccgacggttcgctggacctgtcccaggtagccgcc
gcgatcaaaccggacgacttccatttcgcccgcactcgcttgctggcgctggaaaacacc
atgcaaggcaaagtgttgccgctggagtatctggcccgggctcgaacctttacccaggaa
caaggcctggccctgcacctggacggcgcgcggttgtacaacgcagcggtcaagctgggc
gtggacgcgagggaaatcacccggcatttcgattccgtgtcggtctgtttgtccaaaggc
ctgggcgctccggtcggctctgtactctgtggtacggtggagttgatcgacaaggcgcga
cgcctgcgcaagatggtgggtggcggcatgcgtcaggccgggatcctggcggcagcgggg
ctgtatgcgctggatcacaacgttcagcgtctggccgacgatcacgccaatgcccagatt
ctggctgacggcctgcgaaaggccggttatgacgtggaaccggtacacaccaacatggtg
tacgtgcagatgggcgacaaggccgaggcgatcaaagccttcgccgccgaacgcgggatc
aagctcagtgcggcaggccgcctgaggatggtcacgcacatggacgtcagtcgcgtccag
atcgggcaggtcgtcgcggcattcgtcgaattttcgcgcaactga

DBGET integrated database retrieval system