KEGG   Pseudomonas silesiensis: PMA3_23040Help
Entry
PMA3_23040        CDS       T05412                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
psil  Pseudomonas silesiensis
Pathway
psil00030  Pentose phosphate pathway
psil00480  Glutathione metabolism
psil01100  Metabolic pathways
psil01110  Biosynthesis of secondary metabolites
psil01120  Microbial metabolism in diverse environments
psil01130  Biosynthesis of antibiotics
psil01200  Carbon metabolism
Module
psil_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psil_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
psil_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:psil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PMA3_23040
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PMA3_23040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psil04147]
    PMA3_23040
Enzymes [BR:psil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PMA3_23040
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PMA3_23040
Exosome [BR:psil04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PMA3_23040
  Exosomal proteins of colorectal cancer cells
   PMA3_23040
  Exosomal proteins of bladder cancer cells
   PMA3_23040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ANJ57879
UniProt: A0A191YYP3
Position
complement(5186696..5188165)
Genome map
AA seq 489 aa AA seqDB search
MPSITVEPCTFALFGALGDLALRKLFPALYQLDGAGLLHEDTRIIALAREPGSEQQHLAF
IAAELRRYVNDKELDEAVVERFLARLSYLHVDFLKADDYVALAERAGSAQRVIAYFATPA
AVYGAICENLSKVGLTENTRVVLEKPIGSDLESSRKVNDAVAQFFPENRTYRIDHYLGKE
TVQNLIALRFANSLFETQWNQNYISHVEITVAEKVGIEGRWGYFDKAGQLRDMIQNHLLQ
LLCLIAMDPPADLSADSIRDEKVKVLKALAPISPEGLTTQVVRGQYIAGHSEGKSVPGYL
EEPNSNTQSDTETFVALRADIRNWRWAGVPFYLRTGKRMPQKLSQIVIHFKEPSHYIFAP
EQRLQISNKLIIRLQPDEGISLRVMTKEQGLDKGMQLRSGPLQLNFSDTYRSARIPDAYE
RLLLEVMRGNQNLFVRKDEIEAAWNWCDQLIAGWKKSGDAPKPYAAGSWGPMSSIALITR
DGRSWYGDI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgattacggttgaaccgtgcacctttgccttgttcggcgccctcggcgatctg
gccctgcgcaagctgtttcctgccctctatcaactcgatggcgcgggcctgcttcatgag
gatacgcgcatcatcgcgctggcccgtgaacccggcagcgagcagcagcatctggcgttc
atcgccgccgagctgcgtcggtacgtcaatgacaaagagctggacgaagcggtcgtcgaa
cgcttcctggctcgcctgagctacctgcacgtcgatttcctcaaggctgacgactacgtc
gccctggccgaaagggccggcagcgcccagcgcgtgatcgcctacttcgcgacaccggca
gcggtttacggcgcgatctgcgagaacctgtcgaaggtcggtctgactgaaaacacccgc
gtggtgctggaaaaacccatcggttcggacttggaatcctcgcgcaaggtcaacgacgcc
gtagcgcagttcttcccggagaaccgcacctaccgcatcgaccactacctgggcaaggaa
accgtacagaacctgatcgccctgcggtttgccaacagcctgttcgagacccagtggaac
cagaactacatctcccacgtggaaattaccgtggccgagaaagtcgggatcgaaggtcgc
tggggctacttcgacaaggccggtcagctgcgggacatgatccagaaccacctgctgcaa
ctgctatgcctgatcgccatggacccgccggccgacctgtccgccgacagcattcgtgac
gagaaagtcaaagtcctcaaggccctggcgccgatcagcccggaaggcctgaccacgcaa
gtggtgcgcggccagtacatcgccggccatagcgaaggcaaatcggtccccggttacctg
gaagagccgaactccaacacccagagcgacaccgaaaccttcgttgccctgcgtgccgac
attcgcaactggcgctgggccggtgtgccgttctacctgcgcaccggcaagcgcatgccg
cagaagctgtcgcagatcgtcatccacttcaaggagccgtcgcactacatcttcgcgccc
gagcagcgcttgcagatcagcaacaagctgatcatccgcctgcaaccggacgaaggcatt
tcattgcgggtgatgaccaaagaacaaggcctggacaagggcatgcagctgcgcagcggt
ccgttgcagctgaatttttccgacacttatcgtagcgcacggattcccgatgcctacgag
cggttgttgctggaagtgatgcgcggcaatcagaacctgtttgtccgtaaagatgaaatc
gaagccgcgtggaattggtgtgaccagttgatcgccgggtggaaaaaatccggtgacgcg
cccaagccgtacgcggccgggtcctggggaccgatgagctccattgcactgatcacgcgg
gacgggaggtcgtggtatggcgatatctga

DBGET integrated database retrieval system