KEGG   Pimelobacter simplex: KR76_02395Help
Entry
KR76_02395        CDS       T03528                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
psim  Pimelobacter simplex
Pathway
psim00020  Citrate cycle (TCA cycle)
psim00620  Pyruvate metabolism
psim01100  Metabolic pathways
psim01120  Microbial metabolism in diverse environments
psim01200  Carbon metabolism
psim01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KR76_02395
   00620 Pyruvate metabolism
    KR76_02395
Enzymes [BR:psim01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     KR76_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 GCV_H ATP-grasp_3 RnfC_N NQRA HlyD_D23 DUF2118 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AIY15902
UniProt: A0A0A1DH33
Position
complement(488228..491605)
Genome map
AA seq 1125 aa AA seqDB search
MFSKVLVANRGEIAIRAFRAAYELGATTVAVFPFEDRGSEHRLKADEAYEIGERGHPVRS
YLDPDAIVAAAVACGADAVYPGYGFLSENPALAEACAAAGITFIGPSADVLTLTGNKARA
IAAAKAAGVPTLRSVAPSTDVDALVAAAEEIPVPLFVKAVAGGGGRGMRRVDDRAGLREA
VETCMREAEGAFGDPTVFIEQAVVDPRHIEVQILADAAGDVIHLFERDCSVQRRHQKVVE
IAPAPNLDPALRERMCADAVRFAREIGYSCAGTVEFLVDPDGNYVFIEMNPRIQVEHTVT
EEVTDVDLVQSQMRIASGETLADLGLTQDSIRLRGAALQCRITTEDPANGFRPDTGTITA
YRSPGGAGVRVDAGTVHAGAEVSPHFDSLLAKLTCRGRTFDDAVRRARRAVAEFRIRGVA
TNIPFVAALLDEPEFLAGRVTTSFIETHPELLTARSHGDRATKLLDYLADVTVNRPHGEL
PVHVRPVDKLPALDLTAPVPDGSRQRLLTLGPEAFAAELRAQSAVAVTDTTFRDAHQSLL
ATRVRTHDLLAVAGHVARTTPQLWSLECWGGATYDVALRFLAEDPWDRLARLREAVPNVC
LQMLLRGRNTVGYTPYPTAVTDAFVDEAAATGIDVFRIFDALNDVEQMRPAIEAVRGTGT
AVAEVALCYTGDLSSPGEDLYTLDYYLRLAERIVDAGAHVLAIKDMAGLLRAPAAHTLVT
ALRDRFDLPVHLHTHDTPGGQLATLTAAIDAGVDAVDAACAAMAGTTSQPPLSSLVAATD
HGTRSTGLDLGAVNALEPYWEAVRRVYAPFESGLPAPTGRVYRHEIPGGQLSNLRQQAIA
LGLGEKFEQVEDMYAAANDILGRVPKVTPSSKVIGDLALALVAAGADPEAFAADPSSYDI
PASVIGFLHGELGDPPGGWPEPFRSKAIAGRPWSPPEAELTAEQETALRDDPRPTLNRLL
FPGPTREYEEARARWGDLSVVPTVEYLYGLQHETEHAIDLEEGKRLLVELEATGAPDERG
YRTVLARANGHLRPVSVRDRSVAAEVTAAEKADPAQRGHVAAPFQGVVTITVAEGDQVTA
GDTVATIEAMKMEAAITAPVDGTVQRIALAGPQAVEGGDLVVVVG
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
ttgttctcgaaagtactcgtcgccaaccgtggcgagatcgcgatccgagccttccgcgcc
gcatacgagctgggcgccacgaccgtggccgtcttcccgttcgaggaccggggctccgag
caccgcctgaaggccgacgaggcctacgagatcggcgagcgcggccacccggtgcgcagc
tacctcgaccccgacgccatcgtggccgcggcggtggcctgcggtgcggacgcggtctac
cccggctacggcttcctctccgagaaccccgcgctggccgaggcgtgcgcggcggcgggg
atcaccttcatcggtccgtccgccgacgtgctgacgctgaccggcaacaaggcccgcgcg
atcgcggccgcgaaggcggccggcgtgccgacgctgcgcagcgtggcgccctcgaccgac
gtcgacgcgctggtcgcggccgccgaggagatcccggtcccgctgttcgtcaaggccgtc
gccggtggtggcgggcgcgggatgcggcgggtcgacgaccgggcagggctgcgcgaggcg
gtcgagacgtgcatgcgcgaggccgagggcgcgttcggcgacccgacggtgttcatcgag
caggcggtggtggacccgcggcacatcgaggtccagatcctcgccgacgccgcgggcgac
gtcatccacctgttcgagcgggactgctcggtgcagcgccggcaccagaaggtcgtcgag
atcgccccggcccccaacctcgatcccgcgctgcgcgagcggatgtgcgccgacgcggtg
cggttcgcccgcgagatcggctactcctgcgcgggcacggtggagttcctggtcgacccc
gacggcaactacgtgttcatcgagatgaacccgcggatccaggtcgagcacacggtgacc
gaggaggtcaccgacgtcgacctcgtgcagtcgcagatgcggatcgcgtccggtgagacg
ctggccgacctcggcctcacccaggacagcatccggctgcggggcgcggccctgcagtgc
cggatcacgaccgaggaccccgccaacggcttccgtcccgacacgggcaccatcacggcg
taccgctcgccgggcggcgccggcgtccgcgtcgacgccggcaccgtgcacgcgggcgcg
gaggtctcgccccacttcgactcgctgctggccaagctgacctgccgcgggcgcaccttc
gacgacgccgtacgacgggcacggcgcgccgtggccgagttccggatccgcggtgtcgcc
accaacatccccttcgtggccgccctcctggacgagccggagttcctcgccggccgggtc
accacgtcgttcatcgagacccaccccgagctgctgaccgcccgctcccacggcgaccgc
gccaccaagctgctcgactacctcgccgacgtcaccgtcaaccggccccacggcgagctc
cccgtgcacgtgcggccggtcgacaagctcccggccctcgacctcaccgcccccgtcccc
gacggctctcggcagcggctgctgaccctcgggccggaggcgttcgccgccgagctgcgg
gcccagtcagcggtcgcggtcaccgacaccacgttccgcgacgcgcaccagtcgctgctg
gccacccgggtccgcactcacgacctgctcgccgtggccgggcacgtcgcccggaccacg
ccgcagctgtggtcgctggagtgctggggcggcgcgacctacgacgtcgccctgcggttc
ctcgccgaggacccgtgggaccgcctcgcccggctgcgggaggccgtgccgaacgtctgc
ctgcagatgctgctgcgcgggcgcaacaccgtcggctacacgccctacccgaccgcggtc
accgacgccttcgtcgacgaggccgccgccaccgggatcgacgtcttccggatcttcgac
gccctcaacgacgtcgagcagatgcgtcccgccatcgaggccgtccgcggcaccggcacc
gccgtcgccgaggtcgcgctctgctacaccggcgacctctcctcgcccggcgaggacctc
tacaccctcgactactacctgcgcctggccgagcggatcgtcgacgccggggcgcacgtg
ctcgccatcaaggacatggccggcctgctgcgcgcgcccgccgcgcacaccctcgtgacc
gcgctgcgcgaccgcttcgacctcccggtgcacctgcacacccacgacacccccggcggc
cagctcgccaccctcaccgcggcgatcgacgccggcgtcgacgcggtcgacgccgcgtgc
gccgcgatggccgggacgacgtcgcagccgccgctgtcgtcgctcgtcgcggcgaccgac
cacgggacccgctccaccgggctcgacctgggcgccgtcaacgcgctcgagccctactgg
gaggcggtccgccgcgtctacgccccgttcgagtccgggctgccggccccgaccgggcgg
gtgtaccgccacgagatccccggcggccagctgtccaacctgcgccagcaggcgatcgcg
ctggggctgggcgagaagttcgagcaggtcgaggacatgtacgccgcggccaacgacatc
ctcggccgggtccccaaggtgaccccgtcctccaaggtcatcggcgacctcgcgctcgcg
ctcgtcgccgccggcgcggacccggaggcgttcgcggcggacccgtcgtcgtacgacatc
ccggcgtcggtcatcggcttcctccacggcgagctcggcgacccgcccggcggctggccg
gagcccttccggtccaaggccatcgcgggccggccgtggagcccgcccgaggcggagctg
acggccgagcaggagaccgcgctccgcgacgacccccgcccgacgctcaaccggctcctc
ttccccggcccgacccgcgagtacgaggaggcgcgcgcccgctggggcgacctgtccgtc
gtcccgacggtcgagtacctctacggcctccagcacgagaccgagcacgcgatcgacctc
gaggagggcaagcgcctgctggtcgagctcgaggcgaccggcgcccccgacgagcgcggc
taccgcaccgtcctggcccgggcgaacggccacctgcgacccgtcagcgtccgggaccgc
tcggtcgcggccgaggtcaccgccgccgagaaggccgacccggcacagcgcgggcacgtc
gccgcgcccttccagggcgtcgtcaccatcaccgtcgccgagggcgaccaggtcacggcc
ggcgacaccgtcgccaccatcgaggccatgaagatggaggccgccatcaccgcccccgtc
gacggcacggtccagcgcatcgcgctcgccgggccgcaggccgtcgagggcggcgacctc
gtggtggtcgtcggctag

DBGET integrated database retrieval system