KEGG   Pimelobacter simplex: KR76_03695Help
Entry
KR76_03695        CDS       T03528                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
psim  Pimelobacter simplex
Pathway
psim00860  Porphyrin and chlorophyll metabolism
psim01100  Metabolic pathways
psim01110  Biosynthesis of secondary metabolites
psim01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KR76_03695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psim01007]
    KR76_03695
Enzymes [BR:psim01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     KR76_03695
Amino acid related enzymes [BR:psim01007]
 Aminotransferase (transaminase)
  Class III
   KR76_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIY16084
UniProt: A0A0A1DFQ7
Position
770443..771765
Genome map
AA seq 440 aa AA seqDB search
MPAPLTSGSEALFARARAVTPGGVNSPVRAFNAVGGTPRFIREATGPWLTDVDGNTYVDL
ICSWGPMLLGHAHPAVVEAVQTAAARGSSYGTPTEGEVALVEAIVARTPVERLRLVSSGT
EATMSAIRLARGFTGRDVVVKFAGCYHGHVDSLLAAAGSGLTTFSLPGTPGVPASSTELT
LVLPYNDRAAVTAAFAEHGDRIACLITEAAPGNMGVVPPAPGFNQFLAETCRAHGALFVS
DEVMTGFRVSKAGQWGTDGAVEGWAPDLMTFGKVMGGGFPAAAFGGRADVMSHLAPEGPV
YQAGTLSGNPVATAAGLATLTAADDAVYDRIGVVADALRAGIAETFTAAGLPHVIQSTGS
MFSVFLTDAPVTSYDEAQRTDVAAYGALFHAMLDQGVHLPPSAYEAWFVSSSHDDRAVQQ
VLDALPAAATAAAAAQGGTR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcaccactgacctccggctccgaggcgctcttcgcccgagcccgtgccgtgacg
ccgggcggcgtcaattccccggtccgcgcgttcaacgcggtcgggggcacgccgcgcttc
atccgtgaggccaccgggccctggctcaccgacgtcgacggcaacacctacgtcgacctg
atctgctcgtggggcccgatgctgctcggccacgcccacccggcggtggtcgaggcggtc
cagaccgccgcggcccgcggctcgtcgtacgggacgccgaccgagggcgaggtggccctc
gtcgaggcgatcgtggcccgcaccccggtcgagcgcctgcgcctggtctcgtcgggcacc
gaggcgaccatgtcggccatccggctcgcccgcgggttcaccggccgcgacgtggtcgtg
aagttcgccggctgctaccacggtcacgtcgactcgctcctcgccgcggcgggctccggg
ctgaccaccttctcgctcccggggacgccgggggtgccggccagctccaccgagctcacg
ctcgtgctgccctacaacgaccgcgccgcggtcaccgcggccttcgccgagcacggcgac
cgcatcgcctgcctgatcaccgaggccgcgccgggcaacatgggcgtcgtcccgccggcg
ccgggcttcaaccagttcctcgccgagacctgccgggcccacggcgcgctgttcgtcagc
gacgaggtgatgaccggcttccgcgtctcgaaggcggggcagtgggggaccgacggcgcg
gtcgagggctgggcccccgacctgatgaccttcggcaaggtgatgggcggcggcttcccg
gccgcggcgttcggcggtcgcgccgacgtgatgtcgcacctggcgcccgaggggccggtc
taccaggcgggcaccctctccggtaaccccgtcgccaccgcggccggcctcgccacgctc
accgccgccgacgacgccgtctacgaccggatcggcgtggtcgccgacgcgctgcgcgcc
gggatcgccgagacgttcaccgcggccggcctgccccacgtcatccagtcgaccggctcg
atgttctcggtcttcctcaccgacgccccggtcacgagctacgacgaggcgcagcgcacc
gacgtcgcggcctacggcgcgctcttccacgcgatgctcgaccagggggtccacctcccg
ccgtcggcgtacgaggcctggttcgtctcctcctcccacgacgaccgtgcggtccagcag
gtcctcgacgcgctgcctgccgccgcgaccgcggccgccgcggcccaggggggcacccga
tga

DBGET integrated database retrieval system