KEGG   Pimelobacter simplex: KR76_08555Help
Entry
KR76_08555        CDS       T03528                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psim  Pimelobacter simplex
Pathway
psim00450  Selenocompound metabolism
psim00970  Aminoacyl-tRNA biosynthesis
psim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KR76_08555
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KR76_08555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psim01007]
    KR76_08555
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psim03016]
    KR76_08555
Enzymes [BR:psim01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KR76_08555
Amino acid related enzymes [BR:psim01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KR76_08555
Transfer RNA biogenesis [BR:psim03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KR76_08555
 Prokaryotic type
   Other AARSs
    KR76_08555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF615
Motif
Other DBs
NCBI-ProteinID: AIY16806
UniProt: A0A0A1DHF2
Position
1744362..1746158
Genome map
AA seq 598 aa AA seqDB search
MTHVLSAVAWPYANGPRHIGHVAGFGVPSDVFSRYQRMAGNDVLMVSGSDEHGTPILIAA
DEAGMTPQELADKNHRLIVEDLVALGVSYDLYTRTTTRNHHAVVQELFLGVYENGYFVEQ
TTYGAISPSTGRTLPDRYIEGTCPICGYDGARGDQCDNCGNQLDPHDLIDPRSKINGEKP
EFIETQHFFLDLPALAEALTEWLDGREATGLWRPNVIRFSKNILKEIRPRAMTRDIDWGI
AVPLDGWRENPTKKLYVWFDAVIGYLSASIEWARRSGDPDAWRAWWNDPEALSYYFMGKD
NITFHSQIWPAELLAYAGKGDKGGAPREYGVLNLPTEVVSSEFLTMEGKKFSSSKKIVIY
VHDLLARYQPDAFRYFVASAGPENQDSDFTWAEFVRRTNDELVAGWGNLVNRTATLIAKN
FGELPAAGPLAPEDEAVLAAVEEAFGVVGDLIGKHRQKQAIGEAMRAVAEVNKYVSDSEP
WKLKDEAQRERLGTILHVMAQCVADLNLVLSPFLPFSANEVDKALGGAGTIAPMPRIDEV
ADLDDAERGYPIITGDYDGFPAWRRAPIEVGRAVAKPSPVFVKLDPSVVDDELARLGG
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgtcctctccgctgtcgcctggccctacgccaacggtccccgccacatcggc
cacgtggccggcttcggcgtcccgtccgacgtgttcagcaggtaccagcggatggcgggc
aacgacgtcctgatggtgtccggctccgacgagcacggcacgccgatcctgatcgccgcc
gacgaggcggggatgaccccgcaggagctcgccgacaagaaccaccggctcatcgtcgag
gaccttgtcgcgctgggggtcagctacgacctctacacccgcaccaccacgcgcaaccac
cacgcggtcgtgcaggagctcttcctcggcgtctacgagaacggctacttcgtcgagcag
acgacctacggcgcgatctcgccgtcgaccggacgcacgctgcccgaccgctacatcgag
ggcacctgcccgatctgcggctacgacggcgcccgcggcgaccagtgcgacaactgcggc
aaccagctcgacccgcacgacctgatcgacccgcgctccaagatcaacggcgagaagccg
gagttcatcgagacccagcacttcttcctcgacctgccggcgctggccgaggcgctcacc
gagtggctcgacgggcgcgaggcgaccggcctgtggcggcccaacgtcatccggttctcc
aagaacatcctcaaggagatccggccgcgcgcgatgacccgcgacatcgactggggcatc
gccgtcccgctcgacggctggcgcgagaaccccacgaagaagctctacgtctggttcgac
gcggtgatcgggtacctgtcggcgtccatcgagtgggcccggcgcagcggcgacccggac
gcctggcgcgcgtggtggaacgaccccgaggcgctgtcctactacttcatgggcaaggac
aacatcaccttccactcccagatctggccggccgagctgctcgcctacgccggcaagggc
gacaagggcggcgcaccccgcgagtacggcgtgctcaacctgccgaccgaggtcgtctcc
tcggagttcctcacgatggagggcaagaagttctcctcgtcgaagaagatcgtcatctac
gtgcacgacctgctcgcgcgctaccagcccgacgccttccgctacttcgtcgcctccgcg
ggccccgagaaccaggactccgacttcacctgggccgagttcgtccggcggaccaacgac
gagctcgtggccggctggggcaacctggtcaaccgcacggcgacgctgatcgccaagaac
ttcggcgagctgccggccgcgggcccgctggcgcccgaggacgaggccgtcctggccgcc
gtcgaggaggccttcggcgtcgtcggcgacctgatcggcaagcaccgccagaagcaggcg
atcggcgaggcgatgcgcgccgtcgccgaggtcaacaagtacgtctccgactccgagccg
tggaagctcaaggacgaggcgcagcgcgagcggctgggcacgatcctgcacgtcatggcc
cagtgcgtcgccgacctcaacctggtgctcagcccgttcctgccgttctcggccaacgag
gtcgacaaggccctcggcggcgccggaacgatcgcgccgatgccgcgcatcgacgaggtc
gccgacctcgacgacgccgagcgcggctacccgatcatcaccggcgactacgacggcttc
ccggcctggcgccgggcgccgatcgaggttggccgtgcggtcgccaagccgagcccggtc
ttcgtcaagctcgacccgtcggtggtcgacgacgagctcgcccgcctgggcggctga

DBGET integrated database retrieval system