KEGG   Pimelobacter simplex: KR76_09690Help
Entry
KR76_09690        CDS       T03528                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
psim  Pimelobacter simplex
Pathway
psim00360  Phenylalanine metabolism
psim00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psim00790  Folate biosynthesis
psim01100  Metabolic pathways
psim01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    KR76_09690
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KR76_09690
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KR76_09690
Enzymes [BR:psim01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     KR76_09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIY16962
UniProt: A0A0A1DK17
Position
complement(1990358..1991254)
Genome map
AA seq 298 aa AA seqDB search
MFEEAQYFAPVTADEDGSLKVHLGADHPGFADPAYRARRDALATLANAWTPGTPAPYADY
TAEEHDVWRVVSEALVTKHRAYACREFLDGKEALALPIDHIPQLAEVSEWLEPLTGYRYQ
PAAGLVPLRDFYGSLADKAFWSTQYVRHHSVPLYTPEPDVLHEVVGHGNTLANPRFTALY
ELAGQASRRVESADALEFVSKVFWFTLEFGILWESSELKAYGAGILSSPGEIEAFRGMTI
RPLDVGEMGSMTYDITDYQNVLYVADSFSQVEDVVGTFWAECTDDSIAALQERHPAHT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggaagcccagtacttcgcgcccgtgaccgccgacgaggacggctcgctcaag
gtccacctcggtgccgaccaccccggcttcgccgacccggcctaccgtgcccggcgcgac
gccctcgccacgctcgccaacgcctggacgccgggcacccccgcgccgtacgccgactac
acggccgaggagcacgacgtctggcgcgtggtcagcgaggcgctcgtcaccaagcaccgc
gcgtacgcctgccgggagttcctcgacggcaaggaggcgctggccctgccgatcgaccac
atcccccagctcgccgaggtgagcgagtggctggagccgctgaccggctaccgctaccag
ccggccgcgggcctggtgcccctgcgcgacttctacggctcgctcgccgacaaggcgttc
tggtcgacccagtacgtccggcaccactcggtcccgctctacacgccggagcccgacgtc
ctgcacgaggtcgtcggccacggcaacaccctcgcgaacccgcgcttcaccgcgctctac
gagctcgccggccaggcctcgcgccgggtcgagtcggccgacgcgctggagttcgtcagc
aaggtcttctggttcacgctggagttcggcatcctctgggagagctccgagctcaaggcg
tacggcgccggcatcctctcctcgcccggcgagatcgaggccttccgcggcatgacgatc
cgcccgctcgacgtcggcgagatgggcagcatgacctacgacatcaccgactaccagaac
gtcctctacgtcgccgactcgttcagccaggtcgaggacgtcgtcggtacgttctgggcc
gagtgcaccgacgactcgatcgcggcactgcaggagcgccaccccgcgcacacctga

DBGET integrated database retrieval system