KEGG   Pimelobacter simplex: KR76_18650Help
Entry
KR76_18650        CDS       T03528                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
psim  Pimelobacter simplex
Pathway
psim00030  Pentose phosphate pathway
psim00480  Glutathione metabolism
psim01100  Metabolic pathways
psim01110  Biosynthesis of secondary metabolites
psim01120  Microbial metabolism in diverse environments
psim01130  Biosynthesis of antibiotics
psim01200  Carbon metabolism
Module
psim_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psim_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
psim_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KR76_18650
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KR76_18650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psim04147]
    KR76_18650
Enzymes [BR:psim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     KR76_18650
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     KR76_18650
Exosome [BR:psim04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KR76_18650
  Exosomal proteins of colorectal cancer cells
   KR76_18650
  Exosomal proteins of bladder cancer cells
   KR76_18650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AIY20032
UniProt: A0A0A1DTX6
Position
complement(3783317..3784765)
Genome map
AA seq 482 aa AA seqDB search
MAPKTQKPVTVVLFGATGDLARRKLLPGMLHLFETGLLPQLQIVGTSLDEHTTETFVEFV
HEAVMEFSGDDGDMAAWPEFSKLLHWAPGAEGPAGLRSAVEKAESAWDGDRVRLHYLSVP
PKAALAVVKTLDDADLAAGSRIIMEKPFGVDLDSAKKLNAELHKTFDESQIYRIDHFLGK
EAAQNILAFRFANGLFEPIWHRNNIDHVQIDVPEELGLEQRADFYESTGAYRDMVVTHLF
QVLAFTAMEPPTSLDPSAINDEKNKVFRSLLPIDPANVVRGQYDGYRSIAGVAPESETET
FIALKCYIDNWRWAGVPFYLRTGKRLAEGARIISIAFKEPPRSMFPHNSGVGDHGPDHLT
FDLADKAKMSLSFYGKRPGPGMKLDKLSMQFAMTDTTWAGSVLEAYERLIYDAARGDQTL
FTSAAGIERLWEVSAPLLENPPVVRPYRQGSWGPNQIHQLIAPYAWRLPFERGWRNPNAM
GG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaagacccagaagccggtgacggtcgtgctgttcggcgcgaccggcgacctc
gcacgacgcaagctgctgcccgggatgctgcacctgttcgagaccgggctgctgccgcag
ctgcagatcgtcggcacctcgctcgacgagcacaccaccgagacgttcgtggagttcgtg
cacgaggccgtgatggagttctccggcgacgacggcgacatggcggcctggccggagttc
tcgaagctcctgcactgggcgcccggcgccgaggggccggcgggactgcggtccgccgtc
gagaaggccgagtccgcctgggacggcgaccgggtccgcctccactacctcagcgtgccg
cccaaggccgcgctcgcggtggtcaagacgctcgacgacgccgacctcgcggccggcagc
cggatcatcatggagaagccgttcggcgtcgacctcgactcggccaagaagctcaacgcc
gagctgcacaagaccttcgacgagtcgcagatctaccggatcgaccacttcctcgggaag
gaggcggcgcagaacatcctcgcgttccggttcgccaacggcctcttcgagccgatctgg
caccgcaacaacatcgaccacgtccagatcgacgtccccgaggagctcgggctcgagcag
cgcgccgacttctacgagtccaccggcgcctaccgcgacatggtcgtcacccacctcttc
caggtgctcgccttcaccgcgatggagcccccgacgtcgctcgacccgtcggccatcaac
gacgagaagaacaaggtcttccgctcgctgctgccgatcgacccggccaacgtcgtccgc
ggccagtacgacggctaccgctccatcgccggcgtcgcgcccgagtccgagaccgagacg
ttcatcgcgctcaagtgctacatcgacaactggcgctgggccggcgtcccgttctacctg
cgcaccggcaagcgcctcgccgagggcgcgcggatcatctcgatcgcgttcaaggagccg
ccgcgctcgatgttcccccacaactccggcgtcggcgaccacggccccgaccacctcacc
ttcgacctggccgacaaggccaagatgtcgctgtcgttctacggcaagcggcccggtccc
ggcatgaagctcgacaagctctccatgcagttcgcgatgaccgacaccacgtgggccggc
tcggtgctcgaggcctacgagcggctcatctacgacgccgcgcgcggcgaccagacgctc
ttcacctcggcggccggcatcgagcggctgtgggaggtctccgccccgctcctcgagaac
ccgccggtggtccggccctaccgccagggcagctggggtccgaaccagatccaccagctg
atcgcgccgtacgcgtggcggctgccgttcgagcgtgggtggcgcaacccgaacgcgatg
ggtggctga

DBGET integrated database retrieval system