KEGG   Pimelobacter simplex: KR76_24170Help
Entry
KR76_24170        CDS       T03528                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase BphF3
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
psim  Pimelobacter simplex
Pathway
psim00360  Phenylalanine metabolism
psim00362  Benzoate degradation
psim00621  Dioxin degradation
psim00622  Xylene degradation
psim01100  Metabolic pathways
psim01120  Microbial metabolism in diverse environments
psim01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    KR76_24170
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KR76_24170
   00622 Xylene degradation
    KR76_24170
   00621 Dioxin degradation
    KR76_24170
Enzymes [BR:psim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     KR76_24170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AIY19101
UniProt: A0A0A1DNW9
Position
complement(4909099..4910133)
Genome map
AA seq 344 aa AA seqDB search
MSDQNPQIFVQDVTLRDGMHAIRHRIDPADVKRIVVALDEAGVDAIEVAHGDGLAGGSVN
YGPGSHSDWAWIEAAASVLKNARLTTLLLPGVGTVHDLKHAYDLGVRSVRIATHCTEADV
SAQHIDAARELGMDVSGFLMLSHMAPPEQLAQQAKLMESYGAHCVYVTDSGGRLTMDDVA
ARVQAYRGVLKAETEIGIHAHENLSLSVANSVVAVQNGVYRVDASLAGHGAGAGNCPIEA
FVAVADLMGFEHRCDVFQLQDAADDIVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAERA
AEQYGVDVREILMECGRRRLVGGQEDMIVDIALTIVGEREAAAV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagaacccccagatcttcgtccaggacgtcaccctgcgcgacggcatgcac
gcgatccggcaccggatcgaccccgccgacgtgaagcggatcgtcgtcgccctcgacgag
gccggcgtcgacgccatcgaggtcgcgcacggcgacggcctggccggcggctcggtcaac
tacggccccggctcgcacagcgactgggcgtggatcgaggctgccgcgtcggtgctgaag
aacgcccggctcaccacgctgctgctgcccggcgtcggcaccgtccacgacctgaagcac
gcctacgacctgggcgtgcgctcggtgcgcatcgcgacccactgcaccgaggccgacgtc
tcggcgcagcacatcgacgccgcgcgcgagctcggcatggacgtctccggcttcctgatg
ctctcgcacatggcgccgcccgagcagctcgcccagcaggccaagctgatggagtcgtac
ggcgcccactgcgtctacgtcaccgactccggcggccggctcaccatggacgacgtcgcc
gcccgcgtgcaggcctaccgcggcgtgctgaaggcggagaccgagatcggcatccacgcc
cacgagaacctctcgctgtcggtggccaactccgtggtcgccgtccagaacggcgtctac
cgggtcgacgcctcgctcgccggccacggtgccggggcgggcaactgcccgatcgaggcg
ttcgtcgcggtcgccgacctgatgggcttcgagcaccgctgcgacgtcttccagctgcag
gacgccgccgacgacatcgtgcggccgctccaggaccgcccggtccgggtcgaccgcgag
acgctcaccctcggctacgccggcgtgtactcgtcgttcctgcggcacgccgagcgcgcc
gccgagcagtacggcgtcgacgtccgcgagatcctcatggagtgcggccggcgccggctc
gtcggcggccaggaggacatgatcgtcgacatcgcgctcaccatcgtgggcgagcgcgag
gccgccgccgtctga

DBGET integrated database retrieval system