KEGG   Pseudorhodoplanes sinuspersici: CAK95_00895Help
Entry
CAK95_00895       CDS       T04834                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00030  Pentose phosphate pathway
psin01100  Metabolic pathways
psin01120  Microbial metabolism in diverse environments
psin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CAK95_00895
Enzymes [BR:psin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     CAK95_00895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Hpr_kinase_C Epimerase
Motif
Other DBs
NCBI-ProteinID: ARP97796
UniProt: A0A1W6ZK94
Position
complement(189164..189931)
Genome map
AA seq 255 aa AA seqDB search
MALKDKVAIVTGGNSGIGKAIALELARQGVRIVIDYVVDPAATDALERQIAELGGKSIGV
EADVSKIADLQKLVDAAVSGFSRLDIMVNNAGIETRTSVLDTTEAQYGKVMDVNLKSAFF
GTQIAAKQMIKQGDGGRIINITSVHEDWPMPGNTAYCLAKGGMRMLTRTAGLELASHNIL
VVGVGPGAVATPINLSTMNDPAKLAQLDAAIPLGRMARPEEIASVVGFLAGDGASYLTAT
TIFADGGIMHSSVGL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaagacaaggtggcgattgttacgggtggcaatagcgggattggtaaggcc
attgccctcgaactggcgcggcaaggtgtcagaattgtcatagactatgtcgttgacccg
gccgcgaccgatgcgcttgagcggcagatcgccgagcttggcggcaagtctatcggggtc
gaggcggatgtgagcaagatcgctgatctgcagaagctcgtggatgcggccgtgagcggg
ttcagtcgcctggatatcatggtgaacaatgccggcatcgaaacgcgtacctctgtcctg
gatacgaccgaggctcagtacggcaaggtgatggacgtcaatctcaagagcgccttcttc
ggtacgcaaatcgcagccaaacagatgatcaagcaaggcgatggcggtcgcattatcaac
atcacatcggttcacgaggattggccaatgccgggcaacaccgcttattgccttgccaaa
ggcggcatgcgcatgctcacacgcactgccggtcttgagcttgccagccacaacatcctt
gtcgtgggggtcggtccgggcgctgttgcgacgccgatcaatctcagcacgatgaacgat
ccagccaagcttgcgcaattggatgccgcgattccgctgggacgtatggcgcgccccgaa
gagattgccagtgttgtcggcttcctggccggggatggcgcgagctatctcaccgcaacc
acaattttcgcggatggcggcatcatgcacagcagcgtcggtctctag

DBGET integrated database retrieval system