KEGG   Pseudorhodoplanes sinuspersici: CAK95_04585Help
Entry
CAK95_04585       CDS       T04834                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00630  Glyoxylate and dicarboxylate metabolism
psin01100  Metabolic pathways
psin01110  Biosynthesis of secondary metabolites
psin01120  Microbial metabolism in diverse environments
psin01130  Biosynthesis of antibiotics
psin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CAK95_04585
Enzymes [BR:psin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CAK95_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large
Motif
Other DBs
NCBI-ProteinID: ARQ02743
UniProt: A0A1W6ZZJ4
Position
909001..910008
Genome map
AA seq 335 aa AA seqDB search
MPLTAISDRAVLDNIVGRVEAIKAVDEGLFEVSVGLSVATSGMEAGQLFNMLFGNTSLHP
EVMLKDAVFPDELLAAFGGPRHGISGLRQRVGAGIRALTCSALKPQGSSARELAELARQL
ARGGLDFIKDDHGLADQVYSPFAERVPRIAEAVREARANDGGRTCYLPSLSGNLDQLRRQ
VELARAEGIDAVLIAPMVTGVSAFHTIVRENPDFAFMTHPSMAGAARIAPPLLLGKLFRL
LGADATVFPNYGGRFGYSQDECRELAKAALARWSKFPATVPVPAGGMTLDRVAEMLEFYG
LDVIVLVGGGLLSAGTRITQETAAFVDAVVRHQTA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcacggcaatttccgaccgagctgtactggacaatatcgtaggccgcgtggag
gccattaaagcggttgacgagggcttgttcgaagtcagcgttggactttccgtcgccacc
tccgggatggaagcaggccagctttttaacatgctgttcggcaatacgtcgttgcatccc
gaggtgatgctcaaggatgccgtattccccgacgagttattggctgcttttggcggccca
cgtcatggaatttccggattgcgtcagcgtgtcggtgccggcatccgcgcgttgacctgc
tcggcactcaaacctcagggctcaagcgcacgcgagcttgcggagctggccagacaactg
gcgcgcggtggccttgatttcatcaaagacgatcatggtctggccgaccaagtctacagc
ccctttgccgaacgcgtgccgcggatcgctgaagcggtgcgcgaagcgcgcgcaaacgat
ggcgggcgcacatgctacctgccgtcactgtcgggcaatctcgatcagctccgccgccag
gtcgaactcgcccgcgctgaagggatcgatgcggtcctgatcgcacccatggtcacagga
gtttccgccttccatacgatcgtgcgcgaaaatcccgatttcgctttcatgacgcatcct
tccatggcgggtgcggcgcgcattgccccgccgctactgctgggcaaactgttccgtctt
ctaggcgccgatgcgacggtgtttcccaattacggcggtcgattcggctattcgcaggat
gagtgccgggagctggcaaaggcagcattggcgcgctggagcaagtttcctgctaccgta
ccggttccggcaggcggcatgacgctcgaccgtgtcgccgaaatgctggaattctacggt
cttgatgtgatcgtgctggtcggcggcggacttctgtcagcaggcacgcgcatcacacaa
gaaactgccgccttcgtcgatgcggtcgtgcggcaccaaactgcgtaa

DBGET integrated database retrieval system