KEGG   Pseudorhodoplanes sinuspersici: CAK95_11490Help
Entry
CAK95_11490       CDS       T04834                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00071  Fatty acid degradation
psin00072  Synthesis and degradation of ketone bodies
psin00280  Valine, leucine and isoleucine degradation
psin00310  Lysine degradation
psin00362  Benzoate degradation
psin00380  Tryptophan metabolism
psin00620  Pyruvate metabolism
psin00630  Glyoxylate and dicarboxylate metabolism
psin00640  Propanoate metabolism
psin00650  Butanoate metabolism
psin00900  Terpenoid backbone biosynthesis
psin01100  Metabolic pathways
psin01110  Biosynthesis of secondary metabolites
psin01120  Microbial metabolism in diverse environments
psin01130  Biosynthesis of antibiotics
psin01200  Carbon metabolism
psin01212  Fatty acid metabolism
psin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAK95_11490
   00630 Glyoxylate and dicarboxylate metabolism
    CAK95_11490
   00640 Propanoate metabolism
    CAK95_11490
   00650 Butanoate metabolism
    CAK95_11490
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CAK95_11490
   00072 Synthesis and degradation of ketone bodies
    CAK95_11490
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAK95_11490
   00310 Lysine degradation
    CAK95_11490
   00380 Tryptophan metabolism
    CAK95_11490
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CAK95_11490
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAK95_11490
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CAK95_11490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psin04147]
    CAK95_11490
Enzymes [BR:psin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CAK95_11490
Exosome [BR:psin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAK95_11490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-ProteinID: ARP99640
UniProt: A0A1W6ZR93
Position
complement(2374155..2375363)
Genome map
AA seq 402 aa AA seqDB search
MADAFIYDALRTPRGAGRPSGGLHTLSPIDLGATVLTALAERTGCDRADIDDVVFGCGDP
VEDQGADLARSSLLRAGFDERISGSVVTRFCSSGLDASNAAAARIMAGQADCMIAGGVEM
MSLVPIGGTGGPWGSDAEFNTLTNYAPLGVAADLVATLDGHTRDDVDAYAVESQKRAARA
WNDGRFARSIIPVNDFNGTLCLARDEHPRPNTDVASLAKLKPAFEGMATKGGFGDTVRKR
YPQVNRLNHVHTAGNSAGIVDGASAILLGSEKLGRELDLKPRARFVSFATVGCDPCLMLT
APVDATRKCLSRAGLTLDDIDLFEVNEAFASVVLHFMQETGVSHDRVNVNGGAISLGHPI
GATGTILTGTLLDELERTGGKHGVVTLCVGLGMGVATLIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgcattcatatatgacgcgctgcggacgccgcgcggcgccggccgtccgagc
ggaggtctccatacattatctccgatcgaccttggcgccaccgtgctgacggcgcttgcc
gaacgcaccggctgcgaccgcgctgatatcgacgatgttgtattcggctgcggcgatccg
gttgaagaccagggtgccgaccttgcgcgctcatcgctgctgcgcgcgggctttgacgag
cgcatttccggctccgtcgtgacgcgcttctgttcgtccgggcttgacgcatcgaatgcg
gcagccgcgcgcatcatggctgggcaagccgattgcatgatcgcgggcggcgtcgagatg
atgtcgctcgtcccgattgggggtaccggcggaccttggggcagcgacgccgaattcaac
acccttaccaattacgcgccgctcggcgtcgccgccgacctggtcgccacactcgatggc
catacccgcgacgatgttgacgcttatgccgtggaatcgcagaagcgagcggcgcgtgcc
tggaacgacggacgctttgcacggtccattatccccgtgaacgacttcaacggcacgctg
tgtcttgcgcgcgacgagcacccacgtccaaataccgacgtagcctcgctcgccaagctg
aagcccgcctttgagggcatggcgaccaaaggcggtttcggcgacaccgtgcgcaaacgt
tatccgcaggtaaaccgcctcaatcatgttcacacggccggaaactcggcggggattgtg
gacggcgcctccgccatcctgctgggatcagagaaactgggacgcgaactcgatttgaag
ccccgcgcgcgctttgtgagctttgcgacggtcggctgcgatccgtgtctgatgcttact
gctccggtcgacgctacccgcaaatgcctttcacgtgctggtctgactctcgacgatatt
gatctgttcgaggtgaatgaagccttcgcgtcagtggtgctgcatttcatgcaggagacc
ggcgtgtcgcatgaccgggtcaacgtcaatggcggcgccatctcgctcggccatccgatc
ggtgcaacgggtacgatcctgaccggcacactgctggacgaacttgagcgcaccggcggc
aagcatggcgttgtcacgctgtgcgtcggtcttggcatgggcgtcgccacgctgatcgaa
cgggtttga

DBGET integrated database retrieval system