KEGG   Pseudorhodoplanes sinuspersici: CAK95_13155Help
Entry
CAK95_13155       CDS       T04834                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
psin  Pseudorhodoplanes sinuspersici
Brite
KEGG Orthology (KO) [BR:psin00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CAK95_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ARP99927
UniProt: A0A1W6ZRP1
Position
2738667..2739671
Genome map
AA seq 334 aa AA seqDB search
MDGSLVLPLLIALIAVALAFDVINGMHDAANSIATIVSTRVLRPHYAVAWAAFFNFIAFL
VFGLHVANTIGTGIVSAEIVDSRLIFAALMGAISWNLITWYYGIPSSSSHALIGGLVGGG
LAKVGFSSIVWSGLAKTSAAIVLSPLTGFGLALILVLMVSWAFARSTPYGVDLIFRTGQF
LSASLYSLGHGGNDAQKTMGIIAVLLYSQGYLGSEFYVPFWVVIACQAGMGLGTLMGGWR
IVKTMGSQITRLTPVQGFCAETGGAITLFMATGLGIPVSTTHTITGAIIGVGAAKRVSGV
RWSVANGIVMAWIITIPCTAAISALCFWATRLFG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggacggctcgcttgttcttccgctgctgattgccctgattgcagttgcgcttgccttt
gacgtcattaacggcatgcacgatgccgccaattcgattgcgaccattgtgtcgacgcgg
gtgttgcgaccgcattacgcggtcgcctgggcggccttcttcaatttcatcgcattcctg
gtgttcgggctgcatgtcgcgaacacgatcggtaccggcatcgtatccgccgagatcgtg
gattcacggctgatctttgccgcgctcatgggtgcaatctcgtggaatctgatcacctgg
tattacggcattccgtccagctcctcgcacgcgctgatcggcggtctggtcggcggcggt
ctcgccaaggtcggcttttcctccatcgtctggtctggccttgcaaagaccagtgcggcc
atcgtgttgtcaccgctgaccggattcggactcgcgctgatccttgttctgatggtgtca
tgggcctttgcgcggtcgacgccatacggcgtcgatcttatcttccggaccggccagttt
ctctccgcgtcgctctattcgctcggccatggcggcaacgatgcgcagaaaaccatgggc
atcatcgccgtgctgctctactcgcaaggctatctcggcagcgaattctatgttccgttc
tgggtggtgatcgcctgtcaggccggcatgggtcttgggacgctgatgggcggctggcgc
atcgtcaaaacgatgggctcgcagatcacccggctgacgccggtgcagggcttctgtgcg
gagaccggtggtgcgatcacgctgttcatggcaacggggcttggtattccggtttcgacc
acccatacgatcaccggcgccattattggtgtcggggcggcgaaaagggtctccggtgtg
cgctggagtgtggccaacggcatcgtcatggcctggatcatcaccatcccctgcaccgcg
gcgatttccgctctttgtttctgggcgacacgtctgttcggttga

DBGET integrated database retrieval system