KEGG   Pseudorhodoplanes sinuspersici: CAK95_26535Help
Entry
CAK95_26535       CDS       T04834                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00020  Citrate cycle (TCA cycle)
psin00480  Glutathione metabolism
psin01100  Metabolic pathways
psin01110  Biosynthesis of secondary metabolites
psin01120  Microbial metabolism in diverse environments
psin01130  Biosynthesis of antibiotics
psin01200  Carbon metabolism
psin01210  2-Oxocarboxylic acid metabolism
psin01230  Biosynthesis of amino acids
Module
psin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psin_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAK95_26535
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CAK95_26535
Enzymes [BR:psin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CAK95_26535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ARQ02260
UniProt: A0A1W6ZY61
Position
5451201..5452412
Genome map
AA seq 403 aa AA seqDB search
MAKIKVKNPVVEMDGDEMTRIIWQLIKDKLIHPYLDVDLLYYDLSVQNRDATNDQVTIDA
ANKTKEIGVAVKCATITPDEGRVKEFGLKEMWRSPNGTIRNILGGTIFREPIICKNVPRL
VPGWTQPIIIGRHAYGDQYRATDFKFPGKGKLTIKFEGEDGKVIEKEVFKAPGSGVTMAM
YNLDDSIRDFAYASFNYGLNRNYSVYLSTKNTILKQYDGRFMELFQEIFDKDFKAEFDKR
NLIYQHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKV
VEAEAAHGTVTRHYREHQKGNETSTNSIASIFAWTRGLAHRAKLDNNAALATFAATLEKV
CVDTVESGFMTKDLALLVGPEQKWLSTTGFLDTIDENLKRAMA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtgaagaacccggtcgtcgaaatggacggcgacgagatgacccgc
atcatctggcagctcatcaaggacaagctgatccatccctatctcgatgtcgatctgctc
tactacgatctgagcgtccagaaccgcgacgccaccaacgaccaggtcaccatcgacgcg
gcgaacaagacgaaggaaatcggcgttgccgtgaaatgcgccaccatcacgccggacgaa
ggtcgcgtgaaggaattcggcctcaaggaaatgtggcgctcgccgaacggcaccatccgc
aacattctcggcggcaccatcttccgcgaaccgatcatctgcaagaatgtgccgcgcctc
gtccctggctggacccagccgatcatcatcggccgtcatgcctatggcgatcagtatcgc
gccaccgatttcaagtttcccggcaagggcaagctgacgataaaattcgaaggtgaggac
ggcaaggtcatcgagaaggaagtcttcaaggcgcccggctccggcgtcaccatggcgatg
tacaatctcgatgattcaattcgtgattttgcctacgcctcgttcaattacgggctgaac
cgcaattactcggtctacctgtcgaccaagaacaccatcctgaagcagtatgacggccgc
ttcatggagttgtttcaggagatcttcgacaaggatttcaaagccgagttcgacaagcgc
aatctcatctatcagcaccgcctgatcgatgacatggtcgcctcggcgctgaaatggtcc
ggcggctatgtctgggcctgcaaaaattacgatggcgacgtgcagtcggacatcgtcgcg
cagggcttcggctcgctcggcctgatgacctcggtgctgatgacgccggacggcaaggtg
gtggaggcggaagccgcgcacggcaccgtgacgcgccattatcgcgagcatcagaagggc
aacgagacctcgaccaactcgatcgcctcgatcttcgcctggacccgcggcctcgcccat
cgggccaagctcgacaataacgcggcgctcgcgacattcgcagcgaccctggaaaaggtg
tgcgtcgatacggtcgaaagcggcttcatgaccaaggacctcgccctcctcgtcggcccc
gagcagaagtggctgtcgaccaccggcttcctcgacacgatcgacgagaacctgaagagg
gcgatggcgtag

DBGET integrated database retrieval system