KEGG   Pseudorhodoplanes sinuspersici: CAK95_27775Help
Entry
CAK95_27775       CDS       T04834                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00970  Aminoacyl-tRNA biosynthesis
psin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CAK95_27775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psin03029]
    CAK95_27775
Enzymes [BR:psin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CAK95_27775
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CAK95_27775
Mitochondrial biogenesis [BR:psin03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CAK95_27775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ARQ02488
UniProt: A0A1W6ZYZ8
Position
5737617..5738933
Genome map
AA seq 438 aa AA seqDB search
MSIRDLVETCLANIHNLDGEGSRAFTRIYHEAARQRADVLDRTQAREKGLPLAGMPISIK
DLFDIAGEPTLAGSQVLRDAPPAADDAEIVQHLRNAGAIIIGKTNMTEFALSGLGLNPHY
GTPASPWQRETRRIPGGSSSGAGISVAYNMAIAAIGTDTGGSIRIPAAICGLVGFKPTAA
TIPQRGMLPLSRSFDSIGPIARDVSTCATIYSVLSGQQQTSLTPLPLPSIRLGVVKNIVL
DDLDAQVAKTYEAALSRLSATGIQLQDMALPVLDGHSLYSVHGGMIVAEAYAWHEKLFAE
RSHAYDPRVASRIAHGRRISADDYKAFQAERARLIRQWDIETGSVDAVIMPTIPIIAPTI
READADANYNRLDRLILRNPTIGNLMDACSITLPCHEALDAPVGLMLTARGGRDRELLRI
AKMLEGVLPPRQDAMIQS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcgtgatctggtcgagacctgcctggccaacatccacaatctcgacggcgaa
ggctctcgcgcgttcacgcgaatctatcacgaagcggcccgacaacgggcggacgttctc
gaccggacacaagcacgcgagaaagggctgccattggcaggcatgccaatatcgatcaag
gatcttttcgatatcgcaggagagccgacgctggccggttctcaggtcttaagagacgcg
ccccccgcagcagacgatgccgagatcgtccaacacctgcgaaacgccggcgcgatcatt
atcggcaagaccaacatgaccgagttcgcattaagcggcctcgggctcaacccgcattat
ggcacaccggccagtccatggcagcgcgagacgcggcgcattcccggcggctcgtcatcc
ggcgccggcatttccgtcgcatacaacatggcaatcgccgcgatcggcaccgacaccggc
ggctccatccgcattccggctgcgatatgcggccttgttggattcaagccgaccgccgca
accattcctcaacgcggcatgctgccgctgtcgcgcagtttcgattccatcggtccgatc
gcccgtgacgtcagcacctgcgcaaccatctattccgtgctgtcggggcagcaacaaact
tcgctaacacctctcccactcccatcgatccggctgggcgttgtgaagaacattgtcctt
gatgatctcgatgctcaggtcgcaaagacatacgaggctgcgttaagccgtctgtcggcg
accggcattcaattgcaggatatggcactgccggtgctggatgggcattccctctattcc
gttcacggtggcatgatcgtagccgaagcctatgcctggcatgagaagcttttcgccgag
cgcagccatgcgtacgatccgcgggtcgcttcccggattgcacacggacgtcgtatttct
gcggacgactacaaggcctttcaggccgagcgcgcccgcctgatcaggcaatgggacatt
gagacggggtccgtggacgcagtcatcatgccgacgatcccgatcattgcgccgaccatc
agggaagcggacgctgatgcaaactacaaccggctcgaccgactcatcctgcgcaacccg
acaatcggcaatctcatggatgcatgcagcatcaccctgccatgccatgaagcattagac
gcgcccgtcggcctgatgctgactgcgcgcggcggacgcgatcgtgaactcctccgtatt
gccaagatgctggagggagtcttgccaccgcgacaggatgcgatgatccagtcctga

DBGET integrated database retrieval system