KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_00695
Entry
PSJM300_00695     CDS       T02182                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj02025  Biofilm formation - Pseudomonas aeruginosa
psj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSJM300_00695
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSJM300_00695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psj02044]
    PSJM300_00695
Secretion system [BR:psj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSJM300_00695
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFN76223
Position
148285..148803
AA seq 172 aa
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFQHQVIIPRDPQSGQPT
GQRVHKPLMITKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYYTIELEDAVI
VDVQSRMPNCQDPNMSHFTHLEDVYFTYRKIVWTHEVSGTSGSDDWRTPIAG
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacccccgcgtatctgtccctcgaaggcaccaagcaaggtctgatcaccgccggt
accttcaccgaggattcggtcggcaacatcttccaggaaggtcatgaagatcagatcctg
gtgcaggctttccagcaccaggtcatcattccacgcgacccgcagtcgggtcagcccacc
ggccagcgtgtgcacaagccgctgatgatcaccaaggtcttcgacaagtcctcgccgctg
atcttcaacgccctgacttccggcgagcggctgaacaagtgccgcctggagtggtaccgc
acctcctcgaccggaacccaggagcactactacaccatcgaactggaagacgcggtgatc
gtcgacgtgcagtcgcgcatgcccaactgccaggacccgaacatgtcgcatttcacccac
ctggaagacgtgtacttcacctaccgcaagatcgtctggacccacgaagtctccggtacc
tccggctccgacgactggcgtaccccgatcgccggctga

DBGET integrated database retrieval system