KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_03080Help
Entry
PSJM300_03080     CDS       T02182                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSJM300_03080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psj02044]
    PSJM300_03080
Secretion system [BR:psj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSJM300_03080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AFN76694
Position
complement(692888..694363)
Genome map
AA seq 491 aa AA seqDB search
MTTTAAAVETGNLAEAGILDRIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNENEPVK
KAMVDRMIAEIDAKLSRQMDEILHHPEFQALESSWRGLKLLVDRTNFRENIKLEILNASK
QDLLEDFEDSPEIVQSGLYKHIYTAEYGQFGGQPVGALIANYFFDPSAPDVKTLQYVASV
ASMSHAPFVAAAGPKFFGLESFTGLPDLKDLKDHFEGPQFAKWQSFREQEDARYVGLTVP
RFLLRNPYDPEDNPVKSFVYKENVANSHEHYLWGNTAYTFASRLTDSFAKFRWCPNIIGP
QSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMRKGSDNAAFFSA
NSAQKPKFFGNSEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLEL
ELNKWIRQFVADQENPSAEVRSRRPLRAAQVNVSDVEGEPGWYRVSLSVRPHFKYMGADF
TLSLVGKLDKE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaccgcagccgccgtcgaaaccggcaacctcgccgaagccggcatcctcgac
cgcatcatcgccgaaacccgcctgaccccggatgacgaggcctacgacatcgccaagcgc
ggcgtatcggccttcatcgaggaactgctcaaaccgcagaatgaaaacgagccggtgaag
aaggcgatggtcgatcgaatgatcgccgagatcgacgccaagctcagccggcagatggac
gagattctccaccaccccgagttccaggcgctggaatcctcctggcgcggcctcaaactg
ctggtggaccgcaccaatttccgcgagaacatcaagctggagatcctcaacgcctccaag
caggacctgctggaagacttcgaggacagcccggagatcgtccagtccggcctctacaag
cacatctataccgccgagtatggccagttcggcggccagccggtaggcgccctgatcgcc
aactatttctttgacccgagcgcacccgacgtcaagaccctgcagtatgtggccagcgtc
gccagcatgtcccacgcgcccttcgtcgcggcagccgggccgaaattcttcggcctggaa
agcttcaccgggctgcctgacctgaaggatctcaaggatcacttcgaaggcccgcaattc
gccaagtggcagagcttccgcgagcaggaagatgcccgctacgtgggtctcaccgttccg
cgcttcctgctgcgcaacccctatgaccccgaagacaacccggtcaaaagcttcgtctac
aaggaaaacgtcgccaacagccacgagcattatctctggggcaacaccgcctataccttc
gccagccgcctgaccgacagcttcgccaagttccgctggtgtccgaacatcatcggcccg
cagagcggtggcgcggtggaagacctgccgctgcatcatttcgaaagcatgggcgagatc
gagaccaagattcccaccgaagtgctggtatccgaccgtcgcgagtacgagctggccgaa
gaaggcttcatcgccctgaccatgcgcaaaggcagcgacaacgctgcattcttctccgcc
aactcggcgcagaagccgaagttcttcggcaacagcgaggaaggcaagaccgccgaactg
aactacaagctcggcacccagctgccctacctgttcatcgtcaaccgcctggcacactac
ctgaaggtgctgcagcgcgagcagatcggcgcctggaaggagcgcaccgacctggagctg
gagctgaacaagtggattcgccagttcgttgccgaccaggagaaccccagcgccgaagtg
cgcagccgtcgcccgttgcgcgccgcccaggtcaacgtcagcgacgtggaaggcgagccg
ggctggtaccgcgtcagcctgagcgtccggccgcacttcaagtacatgggtgccgacttc
accctgtcgctggtcggcaagctggataaagagtga

DBGET integrated database retrieval system