KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_03085
Entry
PSJM300_03085     CDS       T02182                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSJM300_03085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psj02044]
    PSJM300_03085
Secretion system [BR:psj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSJM300_03085
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFN76695
Position
complement(694385..694891)
AA seq 168 aa
MAKEGSVAPKERINVTFKPATGNAQEEIELPLKLMVLGDFTQRADDRKIEERKPISIDKN
SFDEVLAKQELSLTLGVPNRLNDEAVDEDLAVQLKINSMKDFNPASLVEQVPELKKLMEL
RDALVALKGPLGNAPAFRKAIESVLSDDDSRERVLGELGLAAKNKLDA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccaaagaaggctcagtagcacccaaggagcgtatcaacgtcaccttcaagcccgcc
accggcaacgcccaggaggaaatcgaactgccattgaagctgatggtactgggcgatttc
acccagcgcgccgacgatcgcaagatcgaagagcgcaagcccatttccatcgacaagaac
agtttcgatgaagtcctggccaagcaggagctgagcctgaccctgggcgtacccaatcgc
ctgaacgacgaagccgtcgacgaagacctggccgttcagctgaaaatcaactcgatgaag
gacttcaaccccgccagcctggtcgagcaggtgccggaactgaagaagctgatggaattg
cgcgacgcgctggtcgcactcaagggcccgctgggcaacgcgcccgccttccgcaaggcc
atcgagagcgtgctttccgacgacgactcgcgcgagcgcgtactcggcgagctgggcctc
gccgccaagaacaagctggacgcctga

DBGET integrated database retrieval system