KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_03990
Entry
PSJM300_03990     CDS       T02182                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj02025  Biofilm formation - Pseudomonas aeruginosa
psj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSJM300_03990
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSJM300_03990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psj02044]
    PSJM300_03990
Secretion system [BR:psj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSJM300_03990
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_29
Other DBs
NCBI-ProteinID: AFN76876
Position
882640..886179
AA seq 1179 aa
MKVFFAKLGAFFRKTWVWSLCLVLMAALLVWFAGPLFAVDDHKFWESATSRLLTISTLFL
IWGLAMVFASWRATIRRKKEEDDQDVQEKLRRDGAIGEEQQELRHRFKQALRTLRSSSLY
RGRSEKWRNELPWYLLLGPQGSGKTSLLDFSGLDFPLNRGENQRLTKDVSGTRYADWYFA
DHAVLIDTAGRYLTQPDAQIDRSAWDTLLGLLRKRRARPLNGVLVNIPVELLLGDNELEL
ENLARQTRQRLHEIHQRLAVDVPVYLVLSKADRILGFEEFFDQLSREESDQVLGVSFRQQ
QKGAEAQVVRQEFEELLRRLNSQVILRMHQERDTQRRGRILDFPHQLGQIGERLGLFIEL
AFAGNRYQRASQLRGFYLTSAPQLQDSLDPLTAGIGRSIGLAGSALPTFRSGRARFINQL
LSRVIFPEAELAGLDQREVRRIDWRQRALYAAAFACMALFGLGWALNFSGNHDRLEQLRE
IAQALGQQRQAIEPQDDALQTLKTLDSSYAATQVFPPRDEVSWLRRGGLYQGEQVDPTLH
QAYRRELEALLLPRVGRQLEAQIRANLDDRERLLGSLRAYLMLQLEQRRDADYLKDWVAA
DWSLRYAGNGIAQNGLNGHFARLLEESFAPYPLNEQLVAQARTQLRSESLANVVYRMLRE
QARSLPDYRLSQRLGPQASQFIGSDYPVPGFYTQRGYQRMFVAQGADLVREILRDNWVLG
EGESLSAKDLSRLMVEMEQLYFRDYANHWSEALAQLNLQPANTAAEGALQLAGLTAANSP
LLQLLVEIRENTRFSGLAEAADQAGEAAEAAQAAGGKLGKAGKLAAVAAEQAQAALLRNL
PDTARKALERRFEPLHRLLDEAGGAGPELASALQALDALHRQLTGLAHASAPEQAAFEMA
RARMAGQPDAINQVHSSAGRLPQPVGKWLGLLAEDSWMLVLSDAYHYLNQRYRSELYAAY
GGSLRQRYPFNAHSESDVALADFREFFKAQGTADSFFDRYLKPFVTGSAGQYRLRRVDGR
GLPLSEEFLAQMGRAQTIRRSFFTENPNEPLILFKLEPYSLDSSLGRADFRFGKQQMEYR
HGPIVQTAFRWPAEGDEGRTSLVVEELGGRRVGIEKNTGPWSLFRLLDLMEVDYHSGRDV
LMLKANLGGLRANYLLHSQRSPNPFDIDLLRGFKLPTTL
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgaaggttttcttcgccaagctcggcgccttttttcgcaagacctgggtctggagcctg
tgtctggtgctaatggccgcgctgctggtctggtttgccggcccgctgttcgcggtcgac
gatcacaagttctgggaatcggccaccagccgcctgttgaccatcagcacgctgttcctg
atctgggggctggccatggtgttcgccagctggcgtgccacgattcgcaggaaaaaggaa
gaagacgaccaggacgtccaggaaaagctgcgacgcgatggggcgatcggtgaagaacag
caagagctgcgccatcgtttcaagcaggcgctgcgtacgttgcgcagttccagcctgtat
cgcgggcgcagtgaaaaatggcgcaacgagttgccctggtacctgctgctcggtcctcag
gggagtggcaagaccagtctgctggatttctccgggctggattttccgctgaaccgtggc
gagaaccaacgcctgaccaaggacgtatccggcactcgctacgcggactggtatttcgcc
gatcacgccgtgctgatcgacacggccggccgctacctgacccagcctgatgcgcaaatc
gaccgcagtgcctgggacaccctgttgggcctgctacgcaagcggcgcgcccgtccgctc
aatggcgtgctggtgaacatcccggtggagctgttgctgggcgacaacgaactcgaactg
gagaacctggcccgtcagacgcggcagcgactgcacgaaatccatcagcgtctggccgtc
gacgtgccggtgtacctggtcttgagcaaggccgaccgtatcctcggcttcgaagagttc
ttcgatcagctgtcacgcgaagaaagcgaccaagtgctcggtgtcagtttccgccagcaa
cagaagggggccgaggcccaggtcgtgcgccaggagttcgaggagctgctgcgccgcctc
aacagccaggtcattttgcgcatgcaccaggagcgcgatacccagcgccgtgggcgaatc
ctcgacttccctcatcaactgggacagataggcgaacgcctcggtctgttcatcgaactg
gccttcgccggtaatcgctaccagcgcgccagccagctacgcggcttctacctgaccagc
gcaccgcaactgcaggacagcctcgatccgctgaccgccggtatcggacgcagcatcggc
ctggccggaagcgctctgcccaccttccgcagcggccgcgctcggttcatcaaccaactg
ctgagccgcgtgatttttcccgaagccgaactggccgggctcgaccagcgcgaagtacgg
cgcatcgattggcgtcagcgtgcgttgtacgccgcagccttcgcttgcatggcgctgttc
ggcctgggctgggcgctgaatttctccggtaaccatgatcggctcgaacagctacgcgag
atcgcccaggcgctcggccagcagcgccaggccatcgaaccgcaggacgatgcgctgcag
accctcaagacgctcgacagcagttatgccgccacccaggtctttccgcccagggatgag
gtttcctggctgcgtcgcggtggcttgtaccagggtgagcaggtcgatccgacgctgcac
caggcctaccgccgtgaactggaagcgctgctgttgccacgtgtcggacgccagctggaa
gcgcagatacgggccaacctggatgaccgtgagcgtctgctcggcagcctgcgtgcctac
ctgatgctgcagctggagcaacgccgcgacgccgactatctcaaggattgggtcgccgcg
gactggtcactgcgttatgccggtaacggcatcgcccagaacggattgaacggccatttc
gcacgcctgctggaggagtcgttcgcaccctatccgctgaacgagcagctggtcgcgcag
gcacgtacgcaactgcgcagcgaatcgctggccaacgtcgtctatcgcatgcttcgcgag
caggctcgcagcctgccggattaccgtctgagccagcgcctcggcccgcaggcgtcgcag
ttcatcggcagtgattatccggttcccggcttctatacccagcgcggctatcaacggatg
ttcgtcgcccagggggcggatctggtgcgggagatcctgcgcgacaactgggtactgggc
gagggcgagagcctcagcgccaaggacctgagccgtttgatggtggagatggagcaactc
tatttccgcgactacgccaaccattggagcgaagcactggcgcagctcaacctgcagccg
gccaatacggctgctgaaggcgcgctgcaactggccggtctgacggctgccaactcgccg
ttgctgcagttgctggtggaaatacgcgagaacactcgcttcagcggccttgctgaagcg
gccgatcaggctggagaggcagctgaagcggcccaggccgcaggcggcaaacttgggaag
gccggcaagctggctgccgtcgccgcggaacaggcgcaggccgcattgctcaggaacctg
cctgatactgcacgcaaggccctggagcgacgcttcgaacccttgcatcgcttgctcgat
gaagcgggcggcgccggccccgagctggccagcgcgcttcaggcactggatgcgctgcat
cggcaactgaccggcctggcgcatgccagtgcgccggaacaggctgcgttcgagatggcc
cgtgcccgtatggctggccagcctgatgcgatcaaccaggtgcacagcagcgccggacgc
ctgccgcagccggttggaaagtggctcgggctgctcgctgaagacagctggatgctggtc
ctcagcgatgcctaccactacctcaaccagcgttatcgcagcgagctgtacgccgcctac
ggtggctcgctgcgccagcgctatccattcaatgcgcacagcgaaagcgacgttgcgctc
gccgacttccgcgagttcttcaaggcgcagggcaccgccgacagctttttcgatcgttac
ctgaagcctttcgtcaccggcagtgcaggccagtatcgtctgcgtcgtgtcgatggccgc
ggtctgccgctgtccgaggagttcctggcacagatgggccgggcgcagaccattcggcgc
agcttcttcacggaaaatcccaacgagccgctgattctgttcaagctggaaccctattcg
ctggattccagccttggtcgggcggacttccgcttcggcaagcagcagatggaataccgt
cacgggccgatcgtgcagacggcattccgctggccggccgagggcgacgaaggacgcacc
agtctggtggtcgaggagctgggtggccggcgtgtcggcatcgagaagaacaccggcccc
tggtcgctgttccgtctgctcgatctgatggaggtggactaccacagcggtcgcgatgtg
ctgatgctcaaggccaacctcggtgggctgcgcgccaactatctgctgcacagccagcgt
tcgccgaacccctttgatatcgacctgctgcgcggcttcaaactgccgacgacactgtga

DBGET integrated database retrieval system