KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_04120Help
Entry
PSJM300_04120     CDS       T02182                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00471  D-Glutamine and D-glutamate metabolism
psj00550  Peptidoglycan biosynthesis
psj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PSJM300_04120 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSJM300_04120 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psj01011]
    PSJM300_04120 (murD)
Enzymes [BR:psj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     PSJM300_04120 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:psj01011]
 Precursor biosynthesis
  Amino acid ligase
   PSJM300_04120 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFN76902
Position
912447..913790
Genome map
AA seq 447 aa AA seqDB search
MLIASDQFRIVVGLGKSGMSVVRHLARRGQPFAVVDTRANPPELATLQAQYPEIEVRCGE
LDVDFLCRASELLVSPGLAVSTPALQAAAARGVKLSGDIELFAREARAPIIAITGSNAKS
TVTTLVGEMAQAAGRKVAVGGNLGTPALDLLNDDVELYVLELSSFQLETTEQLNAEVATC
LNVSEDHMDRYAGLPAYHQAKHRIFRGARQVVVNRDDRLSRPLVGEEVPVWSFGLGKPDF
KGFGLIEENGEKHLAFQFEALMPARELKMRGAHNQSNALAALALGHAVGLPFAAMLQTLR
TFAGLPHRCQWVGERAGVSYYDDSKATNVGAALAAIGGLGADIDGKLVLIAGGDGKGADF
SALREPIGRHCREVILLGRDAGRLACTLQGAVALKQVQGLEEAVQRAAECALPGDAVLLS
PACASLDMFKNFEERGRLFAAAVEALK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcgcttccgaccagttccgcatcgttgtcggcctcggcaagagcggcatgtcc
gtggtacgccacctggcgcgccgtgggcagccgttcgccgtcgtcgatacgcgcgcgaac
ccgccggagctggccactctccaggcgcagtaccctgaaatcgaggtgcgttgcggcgaa
ctggacgtcgacttcctctgccgtgccagtgaactgctggtcagcccggggctggcggtg
agcacaccggcattgcaggctgcggccgcgcgcggcgtcaagctgtccggcgatatcgaa
ctgttcgcacgcgaggcccgggcgccgatcatcgccatcaccggctccaacgcgaaaagc
accgtgaccaccctggtcggcgaaatggcccaggcggccggccgcaaggtggcggtgggc
ggcaacttgggcacgccggcgctggatctgctgaacgacgacgtcgagctctatgtgctc
gaactgtccagcttccagctggaaaccaccgagcagctgaacgccgaagtcgcgacctgc
ctgaacgtcagcgaagaccacatggatcgctacgccggcctgccggcctatcaccaggcc
aagcaccggatcttccgtggcgcgcgccaggtggtggtcaaccgtgacgaccgtctcagc
cggccgctggtgggcgaagaggttccggtctggtcgttcggtctcggcaagccggacttc
aagggcttcgggctgatcgaggaaaacggcgagaagcacctggctttccagttcgaagcc
ctgatgcccgcgcgcgaattgaaaatgcgcggtgcgcacaaccagtccaacgccctcgcg
gcgctggcgctcggccatgccgtcggcctgccgttcgcggcgatgttgcagactctgcgg
accttcgccggtctgccccatcgctgccagtgggtgggtgagcgtgcgggcgtgagctac
tacgacgactccaaggccaccaatgtcggcgccgcgctggcagcgatcggcgggctcggt
gcagatatcgatggcaagctggtgctgatcgccggcggtgatggcaaaggcgcggatttc
tccgcgttgcgcgagccgatcgggcgccactgccgtgaggtgatcctgctcggccgcgat
gccgggcggctggcttgcacgctgcaaggcgccgttgccttgaagcaggtgcaaggtctc
gaggaggcggtacagcgggcggcggaatgcgcgttgccgggcgatgccgtgctgctgtct
ccggcctgcgcgagcctggacatgttcaagaatttcgaagagcgcggccgtctgttcgcc
gccgcggtggaggcgctgaaatga

DBGET integrated database retrieval system