KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_07140Help
Entry
PSJM300_07140     CDS       T02182                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00300  Lysine biosynthesis
psj01100  Metabolic pathways
psj01120  Microbial metabolism in diverse environments
psj01230  Biosynthesis of amino acids
Module
psj_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PSJM300_07140
Enzymes [BR:psj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PSJM300_07140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFN77502
Position
complement(1539064..1540212)
Genome map
AA seq 382 aa AA seqDB search
MTAPALSPTLELACELINRPSVTPLDEGCQQLMSERLAACGFAIEPMHIEDVENFWAIRG
SEGPVLCFAGHTDVVPTGPVQAWQNPPFAACIDEHGMLHGRGAADMKGSLASMIIAVERF
TADHPQHKGQIAFLITSDEEGPAHHGTKAVVERLRERGQRLDWCIVGEPSSTALVGDVVK
NGRRGSLGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQIS
NLNSGTGATNVIPGTLEAVFNFRFSTESTVEGLQQRTATILDKHGLDWHVDWALSGLPFL
TEPGELLDGVAAAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHI
LASDLDLLTEIYYQTLVNLLAC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctgccctgtcgcccaccctggaactcgcctgcgagttgatcaatcgccca
tcggtgaccccgctggacgagggttgccagcagttgatgagcgaacgtctcgccgcctgc
ggcttcgccatcgagccgatgcacatcgaggacgtagagaatttctgggcgattcggggc
agtgaaggcccggtgctgtgcttcgccggccacaccgatgtggtgcccactggtcctgtg
caggcctggcagaatccccccttcgcggcatgcatcgacgagcacggcatgctccacggt
cgtggcgcggcggacatgaagggcagtctggcatcgatgatcatcgcggtggagcgcttt
accgccgaccatccgcagcacaagggacagatcgcctttctcatcaccagcgacgaagaa
ggcccggcgcaccacggcaccaaggcggtggtcgagcgcctgcgcgagcgcgggcagcgg
ctggactggtgcatcgtcggcgagccttcgagcacggcgctggtgggcgacgtggtgaag
aacggccggcgcggctcgctcggtggcaccctcacagttcgtggccagcaaggccacgtg
gcctatccgcacctggcgaagaacccgattcacctggcggcgccggcgctggccgaactg
gccgccgagcactgggacgacggcaacgccttcttcccgccgaccagcttccagatttcc
aacctcaactccggcactggcgccaccaacgtcatccccggcacgctggaggcggtattc
aacttccgtttctccaccgagtccacggtggaaggcttgcagcagcgcaccgcgaccatc
ctcgacaagcatggcctcgactggcacgtcgactgggcgctgtccggcctgcccttcctg
accgagccgggcgaactgctcgacggcgtcgccgcggccatccgcagcgtgaccgggcgc
gaaaccacgccctccaccagcggtggaacatccgacgggcgcttcatcgccaccctcggc
acccaggtggtggagctcggcccggtcaacgccacgattcatcaggtcgacgaacacatc
ctcgccagcgacctcgatctgctgaccgaaatctactaccagaccctggtcaatctgctc
gcatgctga

DBGET integrated database retrieval system