KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_07230Help
Entry
PSJM300_07230     CDS       T02182                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00020  Citrate cycle (TCA cycle)
psj00620  Pyruvate metabolism
psj00650  Butanoate metabolism
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
Module
psj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSJM300_07230
   00620 Pyruvate metabolism
    PSJM300_07230
   00650 Butanoate metabolism
    PSJM300_07230
Enzymes [BR:psj01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     PSJM300_07230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF
Motif
Other DBs
NCBI-ProteinID: AFN77520
Position
complement(1554008..1555411)
Genome map
AA seq 467 aa AA seqDB search
MSGFTLFGEPKEFPRALSERGQKEKFKVNLFTGASMGPAADQSMAEAGIINKRIPYQGNP
VQRKKINAGEVLYIDQHLSHMAELIRQGVLPQVDYAIIEAAAITEDGQIIPTGSVGNSPI
FVQTAKHVIIELNTSAPREYEGMHDIYIPGPAGENARKDIPVYDISTRIGTVGIPVDPAK
VRGIVLSSQPDIPSPLFEPNTETQKIADNLLDFLRAEVKSGRLTNSLAPLQSGVGSVANA
VLNGMRTSEFKDLVVASEVLQDGVFDLIDAGVVKFAAGTAFSLSKKRVDNLASDMAKYAG
KVVFRPQEISNHPEVIRRLGIISFNTALEVDIYGNVNSTHVSGTHMMNGIGGSGDFARNA
RISIFVTTSTAKNGNVSSIVPFVTHVDHTNHDVDVIITEQGFADLRGLAPIEAAERMINN
CMHPDYKQQALDYLEEAKARGGHTPHVLEKAFSWHTHLAEHGTMKLK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttcaccctgttcggcgagccgaaggaattcccccgagcgttgtctgagcgc
ggccagaaagagaagttcaaggtcaacctgttcaccggtgcctccatgggcccggccgct
gaccagtccatggccgaagccggcatcatcaacaagcgcatcccctatcagggcaacccg
gtccagcgcaagaagatcaacgcgggtgaagtgctctacatcgaccagcacctgtcccac
atggcggaactgatccgtcagggcgtactgcctcaggtcgactacgcgatcatcgaagcg
gctgccattaccgaagacggccagatcatcccgaccggctccgtgggcaactccccgatc
ttcgtacagaccgccaagcacgtgatcatcgagctgaacacttctgctccgcgtgagtac
gaaggcatgcacgatatctatatcccgggtcctgccggtgagaacgcccgtaaggacatc
cctgtctacgacatcagcacccgtatcggtaccgtgggtatcccggtcgatccggccaag
gtccgcggcatcgtgctgtccagccagccggacattccttctccgttgttcgagccgaac
actgaaacccagaagatcgccgacaacctgctggacttcctgcgtgccgaagtgaaatca
ggccgcctcaccaacagcctggccccgctgcaatccggagtcggctccgttgccaacgcg
gttctgaacggcatgcggacttccgagttcaaggacctggtggtggcttccgaagtgctg
caggacggcgtgttcgacctgatcgatgcaggcgtcgtgaagttcgccgcaggcaccgcg
ttctccctgtcgaagaagcgcgtggacaacctggcgtccgacatggccaagtacgccggc
aaggtggtgttccgtccacaggaaatctccaaccatcctgaagtcattcgccgcctgggt
atcatttccttcaacacggcactggaagtggatatctacggcaacgtgaactccactcac
gtcagcggcactcacatgatgaacggtatcggtggctcgggtgacttcgcccggaacgct
cgtatcagcatcttcgtgacgacttccacggccaagaacggcaacgtttcctccatcgtg
cctttcgtgacccacgtcgaccacaccaaccatgatgtggacgtgatcatcaccgaacag
ggctttgcggatctgcgcgggctggcccccatcgaggcggccgaacgcatgatcaacaac
tgcatgcacccggactacaagcagcaggccctggactacctggaagaagccaaggcgcgc
ggcggccataccccgcacgtgctggaaaaagccttctcctggcacactcacctggccgag
cacggcaccatgaaactgaagtaa

DBGET integrated database retrieval system