KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_10445Help
Entry
PSJM300_10445     CDS       T02182                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain-containing protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00010  Glycolysis / Gluconeogenesis
psj00071  Fatty acid degradation
psj00350  Tyrosine metabolism
psj00625  Chloroalkane and chloroalkene degradation
psj00626  Naphthalene degradation
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_10445
  Lipid metabolism
   00071 Fatty acid degradation
    PSJM300_10445
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSJM300_10445
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSJM300_10445
   00626 Naphthalene degradation
    PSJM300_10445
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSJM300_10445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFN78155
Position
complement(2286092..2287120)
Genome map
AA seq 342 aa AA seqDB search
MDTTMKAAVVRAFGQPLVIEEVAVPRPGPGQVLMKVEACGVCHTDLHAAEGDWPVKPEPP
FIPGHEGVGHVVAVGAGVTHVREGDRIGVPWLYSACGHCVHCLGGWETLCETQQNTGYSV
NGSFAQYVVADANYVGLLPQSIGFVEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDSKLRLAERLGAQLTVNALTTDPAAFIKKEIGGAHGALV
TAVSPKAFAQAAGMLRRGGTMSLVGLPPGDFPLDIFGMVLNGITVRGSIVGTRLDLQESL
EFAAQGKVGATVATDRLENINAIFAHMHKGEIEGRIVLDMTL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaccatgaaagccgccgtggtacgtgccttcggacaaccgctggtgatcgag
gaggtcgcggtgccacgaccggggccggggcaggtgctgatgaaggtcgaagcctgtggg
gtctgccataccgacctgcacgccgctgagggtgattggccggtaaaacctgagccgccc
ttcatccctggccacgagggcgtcggccacgtggtggcggtgggcgcgggcgtcacgcat
gtacgcgaaggcgaccgtatcggcgtaccgtggctgtattcggcctgcggccactgtgtg
cattgtctcggcggctgggaaacactgtgcgaaacgcagcagaacaccggctattcggtc
aacggcagcttcgcccagtacgtggtggccgatgccaactatgtcggtctgctgccccag
agcatcggtttcgttgagatcgcgccggtgctatgcgccggcgtgaccgtctacaagggt
ctgaaggtcaccgacaccaagccaggcgactgggtggtgatctccggcatcggtgggctc
ggccacatggcggtgcagtatgccaaggccatgggcctgaacgtggcggcggtcgatatc
gacgacagcaagctgcgcctggctgaacgcctcggcgcccagctcacggtcaatgcgctc
actacagacccggctgccttcatcaagaaagaaatcggcggtgcacacggtgcgctggtc
actgcggtatcaccgaaagccttcgcccaggccgccggcatgctgcgtcgtggcggcacg
atgtcgttggttgggctgccgccaggggacttcccgctggacatcttcggcatggtgctc
aatggcatcaccgtgcgcggttcgatcgttggcacccggctggatctgcaggagtcactt
gagttcgcagcgcaaggcaaagttggcgccactgtcgccacggatcgcctggaaaacatc
aatgcgatctttgcacacatgcacaagggtgagattgagggccgcatcgtgctcgatatg
acgctgtag

DBGET integrated database retrieval system