KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13475Help
Entry
PSJM300_13475     CDS       T02182                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00020  Citrate cycle (TCA cycle)
psj00310  Lysine degradation
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
Module
psj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSJM300_13475
  Amino acid metabolism
   00310 Lysine degradation
    PSJM300_13475
Enzymes [BR:psj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSJM300_13475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N DUF2868
Motif
Other DBs
NCBI-ProteinID: AFN78757
Position
2957225..2958442
Genome map
AA seq 405 aa AA seqDB search
MAIEIKAPQFPESVADGTVATWHKQPGEAVKRDELIVDIETDKVVMEVLAEADGVLTEIV
KNEGDTVLSGELLGKLEAGATASAAPAPAAAPATAPAAAPAAASAEEAILAPAARKLAEE
NGIDPNSVKGTGKDGRVTKEDVVAAIEAKKSAPAAAKPAASAAAAPVVAAGDRTEKRVPM
TRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKELFEKTHNGVRLGFMSFFVK
ASVEALKRFPAVNASIDGSDIVYHGYQDIGVAVSSDRGLVVPVLRNAELMSLAEVESGIA
TFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAING
QVVIRPMMYLALSYDHRLIDGKEAVSFLVTIKNLLEDPARLLLDI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccccaattcccggaatcggtcgctgacggcaccgttgcc
acctggcacaagcaaccgggcgaagcagtcaagcgtgacgaattgatcgtcgatatcgag
accgacaaggtcgtgatggaagtactcgccgaagccgatggcgtgctgaccgaaatcgtc
aagaacgaaggcgacaccgtgctcagcggcgagttgctcggcaagctggaagcgggtgcc
accgcttcggcagcgccagcgcccgcagcggcacctgccaccgctccggctgccgctccc
gccgctgccagcgccgaagaggcgatcctcgcgccagccgctcgcaagctcgccgaagag
aatggcatcgaccccaacagcgtgaagggcaccggcaaggacggtcgcgtcaccaaggaa
gacgtggttgctgccatcgaggccaagaagtccgctccggccgcagccaagcctgctgcc
agcgctgccgctgcgcctgtcgttgcagccggtgaccgcaccgagaagcgtgtgccgatg
acccgtctgcgtgccaaggttgccgagcgtctggtcgaggcacagtcgaacatggcgatg
ctgaccaccttcaacgaagtcgacatgaccgaagtcatggcgctgcgttcgaagtacaag
gagctgttcgagaagactcacaacggcgtacgcctgggtttcatgtccttcttcgtcaag
gcttccgtcgaggcgctgaaacgcttcccggcggtcaacgcctcgatcgacggcagcgac
atcgtctaccacggctatcaggacatcggcgttgccgtttccagcgaccgtggtctggtc
gtgcccgtgttgcgcaatgccgagctgatgagcctggcggaagtcgaaagcggcatcgcg
accttcggcaagaaggcccgcgacggtaaactgtcgatcgacgaaatgactggtggtacc
ttcaccatcaccaacggtggtactttcggttcgatgatgtccactcctatcgtcaatccg
ccgcaagccgccatcctgggcatgcacaacatcctgcaacgaccgatggccatcaatggt
caggtggtcatccggccgatgatgtacctggcgctgtcctacgatcatcgcctgatcgac
ggcaaggaagcggtcagcttcctggtgaccatcaagaacctgctggaagacccggcccgc
ctgctgctggacatctaa

DBGET integrated database retrieval system