KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_15625Help
Entry
PSJM300_15625     CDS       T02182                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
psj  Pseudomonas stutzeri DSM 10701
Brite
KEGG Orthology (KO) [BR:psj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PSJM300_15625 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AFN79185
Position
3405367..3405750
Genome map
AA seq 127 aa AA seqDB search
MPEDLRYRIDVSVTPQYLPEQSQPEQSRYAFAYRVTIENKGQLSAQLLSRHWIITDGDGQ
VQEVRGAGVVGEQPLLAPGEQHVYTSGTLMNSSVGTMQGSYQMLAEDGHSFDAIIAPFRL
AVPGALH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagatctccgctaccggatcgacgtcagcgtcacgccccagtacctgcctgag
cagtcgcagccggaacaaagccgctatgcctttgcctacagggtaaccatcgaaaacaag
ggccagctctcggcacagctgctgtcgcgccactggatcatcaccgacggcgacgggcag
gtgcaggaagtccgcggtgccggcgtggtcggcgaacaaccgctgctggcgcccggcgaa
cagcatgtctacaccagcggcaccctgatgaactccagcgtgggcaccatgcagggcagc
tatcagatgcttgccgaggacggtcacagcttcgatgcgatcatcgcccccttccgcctg
gccgttcccggagcactgcattga

DBGET integrated database retrieval system