KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_16230Help
Entry
PSJM300_16230     CDS       T02182                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00360  Phenylalanine metabolism
psj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psj00790  Folate biosynthesis
psj01100  Metabolic pathways
psj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PSJM300_16230 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSJM300_16230 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSJM300_16230 (phhA)
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     PSJM300_16230 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AFN79304
Position
3531539..3532324
Genome map
AA seq 261 aa AA seqDB search
MKHTQYVAREPDAHGHIHYPDAEHAVWQTLIERQLKLLDGRACQEYLDGIEQLALPHERI
PQLDEINRVLAATTGWQVARVPALIPFQTFFELLASKRFPVATFIRTPEELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGQLGLRASKEERVYLARLYWMTIEFGLVDTPAGRRIYG
GGILSSPKETLYCLSDEPEHQPFDVVEAMRTPYRIDILQPVYFVLPQLRRLFDVAHEDIM
AHVRSAMQLGLHQPKFPPKAA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatacgcaatacgtcgcccgcgaaccggacgcgcacggccatatccattacccg
gacgccgagcacgccgtctggcagaccctgatcgaacgccagctgaaactgctcgacggc
cgcgcctgccaggaatacctggacggtatcgaacagctcgccctcccccacgagcgcatt
ccgcagctggacgaaatcaaccgcgtgctcgccgcgaccaccggctggcaggtggcgcgc
gtgccggcgctgattcccttccagacctttttcgagctgctggcaagcaagcgcttcccc
gttgccaccttcatccgcacgccggaagaactggactacctgcaggagccggacatcttc
cacgaaattttcggccactgcccgctgctgaccaacccctggttcgccgagttcacccat
acctacggccagctcggcctcagggccagcaaggaggagcgcgtctacctggcgcggctg
tactggatgaccatcgaattcggcctggtggacacgccagccggccggcgcatctacggc
ggcggcatcctttcttcgccgaaggagacgctctattgcctctcggacgagcccgagcat
caacccttcgatgtggtcgaagccatgcgcacgccataccgcatcgacatcctgcagccg
gtgtacttcgtcctgccgcaactgcgccggctgttcgacgtggcccacgaagacatcatg
gcccacgtgcgcagtgccatgcagctgggcctgcaccagccgaagtttccgccgaaagcc
gcgtag

DBGET integrated database retrieval system