KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_16500Help
Entry
PSJM300_16500     CDS       T02182                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00330  Arginine and proline metabolism
psj00332  Carbapenem biosynthesis
psj01100  Metabolic pathways
psj01130  Biosynthesis of antibiotics
psj01230  Biosynthesis of amino acids
Module
psj_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSJM300_16500
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PSJM300_16500
Enzymes [BR:psj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PSJM300_16500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFN79358
Position
complement(3595577..3596695)
Genome map
AA seq 372 aa AA seqDB search
MRDKVSGARRWVVKIGSALLTADGRGLDQAAMAVWVDQMVALRAAGIELVLVSSGAVAAG
MSRLGWAARPRAVHELQAAAAVGQMGLIRAWEASFARCDQQTAQILVTHDDLSDRKRYLN
ARSTLRTLLDLNVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRSNPDANLISEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAYTVIVGG
RIEQVLARLKSGEQLGTLLAPERSRHAARKQWLAGHLQTRGTLTLDAGAVHALRQGHRSL
LPVGVKAVAGGFRRGEMVVCVGPEGQEVARGLVNYSAIEAQRILGRPSDEIEKLLGYVDE
PELIHRDNMILV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgagcggcgctcggcgctgggtggtgaagatcggcagtgcgctgctg
actgcggacggccgggggctcgatcaggcggcgatggccgtctgggtcgatcagatggtg
gcgctgcgggcggcaggcatcgagctggtgctggtttcttccggtgcggtggcggccggt
atgagtcgtctgggttgggcggctcgcccgagggcggtccacgagctgcaggcggccgcc
gcggttggccagatggggctcatccgtgcctgggaagccagcttcgctcgttgcgatcag
caaacggcgcagattctcgtcacccatgacgacctgtccgatcgcaagcgctatctcaac
gcccgcagcaccctgcggacactgctcgatctgaatgtcgtgccggtgatcaacgagaac
gacaccgtcgtcaccgacgagatccgcttcggcgacaacgacacgctggcggcgctggtc
gccaacctggtcgaggccgatctgctggtgatcctgaccgaccgtgacggcatgttcgac
gccgatccgcgcagcaaccccgatgccaatctgatcagcgaggcgcgtgccgacgacccg
gcgctggacgcggtggcgggcgggaccggcggcgcgctggggcgtggcggcatgcagacc
aagctgcgcgcggcacgtctggcggcgcgttccggtgcttatacggtgatcgtcggtggg
cgtatcgagcaggtgctggcgaggctcaagtccggcgagcagctgggtacgctgctggcg
cccgagcgcagccggcatgccgctcgcaagcagtggctggcggggcatctccagactcgc
ggcaccctgacgctggatgcgggtgccgtgcatgccttgcgacagggacatcggagcctg
ttgccggtgggtgtgaaggcggtggccggtggttttcggcggggcgaaatggtggtttgc
gtggggcccgaggggcaggaagttgcccgtggcctggtgaactacagtgctatcgaggcg
cagcggattctcggcaggccatccgacgagatcgagaaacttctcggttacgtcgacgag
ccggaactgatccatcgcgacaacatgattctggtctga

DBGET integrated database retrieval system