KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_19075Help
Entry
PSJM300_19075     CDS       T02182                                 

Definition
(GenBank) putative CoA transferase, subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00072  Synthesis and degradation of ketone bodies
psj00280  Valine, leucine and isoleucine degradation
psj00650  Butanoate metabolism
psj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PSJM300_19075
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PSJM300_19075
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSJM300_19075
Enzymes [BR:psj01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     PSJM300_19075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AFN79868
Position
4139127..4139825
Genome map
AA seq 232 aa AA seqDB search
MAGLDKRVSTYEEALAGLTDGMTVLAGGFGLCGIPENLIAEIRRRGVKDLTVVSNNCGVD
GFGLGVLLEDRQIRKMIASYVGENALFEQQLLNGELEVELTPQGTLAEKMRAGGAGIPAF
YTATGYGTPVAEGKEVREIDGRHYILEHAIRGDFAIVKGWKADHFGNVMYRHTAQNFNPL
AATAGKITVVEVEEIVEPGELEPSQIHTPGIYVDRIIQGSFEKRIEKRTLRD
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcaggactcgacaaacgcgtcagtacctatgaagaggccctggcagggctcacggac
ggcatgaccgtgctggccggcggctttggcctgtgtggcatcccggaaaacctcatcgcg
gaaatccgccggcgcggcgtcaaggacctgaccgtggtttccaacaactgcggcgtggat
ggcttcggcctcggcgtgctgctggaagatcgccagatccgcaagatgatcgcctcgtac
gtcggcgagaacgccctgttcgagcaacagctgctcaacggtgagctggaagtcgaactc
accccccaaggcaccctggcggagaagatgcgcgccggcggtgcgggcattccggccttc
tacaccgcgaccggttacggcacgccggtcgccgaaggcaaggaagtgcgtgaaatcgac
ggacgtcattacatcctcgagcacgccatccgcggcgacttcgccatcgtcaaaggctgg
aaggccgatcatttcggcaacgtgatgtaccgccacaccgcgcagaacttcaacccgctg
gccgccaccgccggcaagatcaccgtggtcgaagtagaggaaatcgtcgagcccggcgag
ctggagcccagccagattcacacgccgggcatctatgtcgatcgcatcatccagggcagc
ttcgagaagcgcatcgagaagcgcacgttgcgcgactga

DBGET integrated database retrieval system