KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_19085Help
Entry
PSJM300_19085     CDS       T02182                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00071  Fatty acid degradation
psj00072  Synthesis and degradation of ketone bodies
psj00280  Valine, leucine and isoleucine degradation
psj00310  Lysine degradation
psj00362  Benzoate degradation
psj00380  Tryptophan metabolism
psj00620  Pyruvate metabolism
psj00630  Glyoxylate and dicarboxylate metabolism
psj00640  Propanoate metabolism
psj00650  Butanoate metabolism
psj00900  Terpenoid backbone biosynthesis
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
psj01212  Fatty acid metabolism
psj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSJM300_19085
   00630 Glyoxylate and dicarboxylate metabolism
    PSJM300_19085
   00640 Propanoate metabolism
    PSJM300_19085
   00650 Butanoate metabolism
    PSJM300_19085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSJM300_19085
   00072 Synthesis and degradation of ketone bodies
    PSJM300_19085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSJM300_19085
   00310 Lysine degradation
    PSJM300_19085
   00380 Tryptophan metabolism
    PSJM300_19085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSJM300_19085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSJM300_19085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSJM300_19085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psj04147]
    PSJM300_19085
Enzymes [BR:psj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSJM300_19085
Exosome [BR:psj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSJM300_19085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFN79870
Position
4140547..4141725
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAIGSFQGALANVPAVDLGAAVIQRLLEQTGVPGEQVDEVILGHVLTAG
AGQNTARQAAVKAGLPHGVSSMTLNKVCGSGLKAVQLAAQAIRCGDAEVVIAGGMENMSL
APYVMPGARTGLRMGHGKIVDTMIQDGLWDAFNDYHMGITAENLVEKYNLSREEQDAFAA
ASQQKAAAAIETGRFADEITPILIPQRKGEPLAFAVDEQPRAGTTAEALAKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSAEKAQALGLPVLARIAGYASAGVDPAIMGIGPVDATRRT
LAKAGWDIQQLDLIEANEAFAAQSLSVGKELNWDAAKVNVNGGAIALGHPIGASGCRILV
TLLHEMIRRDAHKGLATLCIGGGQGVALAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgttgccgccacgcgcaccgcgattggcagtttccagggcgcg
ctggccaatgtgcccgccgtcgacctcggcgccgccgtgatccagcgcctgctggagcag
accggcgtgccgggcgaacaggtcgatgaggtgatcctcggccacgtgctcaccgccggc
gccgggcagaacaccgcccgccaggcggcggtcaaggccggcctgccccacggcgtgtcc
tccatgaccctgaacaaggtctgcggctcgggcctcaaggcagtgcaactggcggcccag
gcgatccgctgcggcgatgccgaggtggtgatcgccggcggcatggagaacatgagcctg
gcgccttacgtcatgcccggcgcccgcaccggcttgcgcatgggtcatggcaagatcgtc
gacaccatgatccaggatggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaatctggtggagaagtacaacctgtcccgcgaggagcaggacgccttcgccgcc
gcctcgcagcagaaggccgcagcggccatcgaaaccgggcgtttcgccgacgagatcact
ccgatcctgattccccagcgcaagggcgagcccctggccttcgccgtcgacgagcaaccg
cgcgccggcaccaccgccgaggcgctggccaagctcaagccggcgttcaagaaggacggc
agcgtcaccgcgggcaacgcctccagcctcaacgacggcgccgccgcagtgctgctgatg
agcgcggaaaaggcccaggccctcggcctgccggtgctggcacgcatcgccggttacgcc
agtgccggcgtagacccggcgatcatgggcatcggcccggtggacgccacccgccgcacg
ctggccaaggccggctgggatatccagcagctcgacctgatcgaggccaacgaagccttc
gccgcccagtcgctgtcggtcggcaaggaactgaactgggacgccgccaaggtcaacgtc
aacggcggcgccatcgccctcggccatccgatcggcgcttccggctgccgaatcctggtc
accctgctgcacgaaatgatccgccgtgatgcccacaaggggctggccacgctgtgcatt
ggcggcggtcagggtgtggcgctggccgtcgaacgctga

DBGET integrated database retrieval system