KEGG   Pseudomonas sp. TKP: U771_01125Help
Entry
U771_01125        CDS       T02969                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    U771_01125
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     U771_01125
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     U771_01125
    1.1.1.-  
     U771_01125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AHC32789
Position
251573..252667
Genome map
AA seq 364 aa AA seqDB search
MTLSLNSQRSMRAAVWHGRNDIRVEDVPLPVSPPAGWVQIRVQWCGICGSDLHEYVAGPV
FIPVDAPHPLTGIKGQCILGHEFCGEIVELGAGVQGFSVGEPVAADACQHCGTCYYCTHG
LYNICENLAFTGLMNNGAFAELVNVPANLLYKLPANFPAEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSGARKAKAREVGATHVLDPNQCDAL
AEVRRLTGGLGADVSFECIGNKHTAKLAIDLIRKAGKCVLVGIFEEPSEFNFFELVATEK
QVLGALAYNGEFADVIAFIADGRLDITPLVTGRIQLEQIVGQGFEELVKNKEHNVKIIVS
PARV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcgctcaactcgcaacgcagcatgcgtgccgctgtctggcacggtcgtaac
gatatccgcgtcgaagacgttccactgcccgtttcgccgcctgccggttgggtgcagatc
cgagtgcaatggtgcggcatttgcggctcggatttgcatgagtacgtggccggcccggtg
ttcataccggttgacgccccgcacccgctgaccgggataaaaggccagtgcattctcggt
cacgagttttgtggcgagatcgtcgaactcggtgccggcgtgcagggcttcagcgtcggc
gagccggtggcggccgatgcgtgccaacattgcggcacctgctactactgcacccacggg
ctatacaacatttgcgagaacctggccttcaccggcctgatgaacaacggcgccttcgcc
gaactggtcaacgtaccagccaacctgctgtacaagttgccggcgaactttccggctgaa
gccggcgcactgatcgagcctctggcggtgggcatgcacgcggtgaaaaaggccggaagc
ctgctggggcaaaacgtggtggtggtcggcgcgggcaccattggcctgtgcaccatcatg
tgcgccaaggcggcgggtgcggctcaggtgatcgccctggagatgtccggagcgcgcaag
gccaaggcccgggaagtgggggcgacccatgtgctcgatcccaatcaatgcgatgccctg
gccgaggtacgacgcctgacgggcgggctcggcgcggatgtcagtttcgaatgcatcggc
aacaaacacacggccaagctcgcgatcgacctgatccgcaaggccggcaagtgcgtactg
gtgggcatcttcgaggagcccagtgagttcaactttttcgagttggtggcgacggaaaaa
caggtactcggcgcgctggcctataacggtgaattcgctgacgtgatcgcttttatcgcc
gatggtcggctggacatcacgccactggtgacggggcgcattcagttggaacagatcgtg
ggccagggcttcgaggaactggtcaaaaacaaggaacacaacgtgaaaatcatcgtgtca
cccgctcgggtctga

DBGET integrated database retrieval system