KEGG   Pseudomonas sp. TKP: U771_05555Help
Entry
U771_05555        CDS       T02969                                 

Definition
(GenBank) carbon-nitrogen hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
psk  Pseudomonas sp. TKP
Brite
KEGG Orthology (KO) [BR:psk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U771_05555
Enzymes [BR:psk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     U771_05555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF442
Motif
Other DBs
NCBI-ProteinID: AHC33659
Position
1224651..1225499
Genome map
AA seq 282 aa AA seqDB search
MSFAVIQMVSQSDVLANLAQARRLLERAAAGGAKLAVLPENFAAMGRRDVADIGRAEALG
EGPILPWLKQTARDLTLWIVAGTLPLPPRDQPDAKVNACSLLVNDQGEIVARYDKLHLFD
VDVADARGRYRESDDYAFGSHVVLADTPVGRLGLTVCYDLRFPELYSELRAAGAELITAP
SAFTAVTGAAHWDVLIRARAIETQCYLLAAAQGGVHPGPRETFGHAAIVDPWGRILTQQD
QGEAVLLAERDSSEQASIRARMPVVNHRRFFSQGAQRPASER
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgcggtaattcagatggtcagccagagcgatgtgctggccaacctggcccag
gcccggcgcttgctggagcgagcggcagcgggcggggcgaagcttgcggtgctgccggaa
aactttgccgccatgggacgccgtgacgtggctgatatcggccgtgccgaggcattgggt
gaaggtccgatcctgccatggttgaaacagaccgcccgcgacctcaccttatggatagtt
gcaggcacattgccgctgccgcccagggaccagccggatgccaaggtcaacgcctgctcg
ttgctggtgaatgaccagggcgagatagtggcccgatacgacaagctgcacttgttcgat
gtcgacgtggcggatgcccgaggccgttatcgtgaatccgatgactatgctttcggcagc
catgtggtgctggcggatacgccggttggccgcttgggcctcacggtatgctacgacttg
cgtttccccgagctgtacagcgaattgcgcgcggccggggctgagttgattaccgcgcct
tcggcctttacggcggtgaccggcgccgcgcactgggatgtgttgatccgcgcgcgggcc
atcgagacccagtgctacctgctggcggccgcccagggcggtgtccacccagggccccgg
gaaacctttggccatgcggcgattgtcgacccgtgggggcgcatactgacgcaacaggat
caaggcgaagcggtgttgctggccgagcgcgacagcagtgaacaggcgtcgatacgggcg
cgcatgccggtggtgaaccatcggcgctttttttcgcagggcgcgcagcggcctgcttca
gaacgatga

DBGET integrated database retrieval system