KEGG   Pseudomonas sp. TKP: U771_09735Help
Entry
U771_09735        CDS       T02969                                 

Definition
(GenBank) Gpo
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00480  Glutathione metabolism
psk00590  Arachidonic acid metabolism
psk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    U771_09735
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    U771_09735
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     U771_09735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AHC34490
Position
2101856..2102341
Genome map
AA seq 161 aa AA seqDB search
MSDNLLSIPCTTIKGEQKTLADYAGKAILVVNTASKCGFTPQYKGLEQLWQTYKDKGLVV
LGFPCNQFGKQEPGNEGAISEFCELNFGVSFPLFKKIDVNGSAAHPLFVQLKKQAPGLLG
SKGIKWNFTKFLIGRDGQVVKRFAPTTKPQDLTQEIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacctgctgagtatcccttgcaccaccatcaagggtgagcaaaagaccttg
gccgattacgccggcaaggccatcctggtggtcaataccgccagcaagtgcggttttacc
ccgcagtacaaggggctggagcagctttggcagacctataaggacaagggcctggtggtg
ctggggttcccctgcaaccagttcggcaagcaggaaccgggcaacgaaggcgcgatttcc
gagttctgcgagctgaacttcggcgtcagctttccactgttcaagaagatcgatgtcaac
ggcagcgcggcccatcccctgtttgtgcagttgaaaaaacaggcgccgggcctgctgggc
tccaagggcatcaagtggaacttcaccaaattcctgatcggccgcgacggtcaggtcgtc
aagcgctttgccccgacgaccaagccgcaggacttgacccaagagatcgaagccctgctc
aaatga

DBGET integrated database retrieval system