KEGG   Pseudomonas sp. TKP: U771_11785Help
Entry
U771_11785        CDS       T02969                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00071  Fatty acid degradation
psk00072  Synthesis and degradation of ketone bodies
psk00280  Valine, leucine and isoleucine degradation
psk00310  Lysine degradation
psk00362  Benzoate degradation
psk00380  Tryptophan metabolism
psk00620  Pyruvate metabolism
psk00630  Glyoxylate and dicarboxylate metabolism
psk00640  Propanoate metabolism
psk00650  Butanoate metabolism
psk00900  Terpenoid backbone biosynthesis
psk01100  Metabolic pathways
psk01110  Biosynthesis of secondary metabolites
psk01120  Microbial metabolism in diverse environments
psk01130  Biosynthesis of antibiotics
psk01200  Carbon metabolism
psk01212  Fatty acid metabolism
psk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    U771_11785
   00630 Glyoxylate and dicarboxylate metabolism
    U771_11785
   00640 Propanoate metabolism
    U771_11785
   00650 Butanoate metabolism
    U771_11785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U771_11785
   00072 Synthesis and degradation of ketone bodies
    U771_11785
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U771_11785
   00310 Lysine degradation
    U771_11785
   00380 Tryptophan metabolism
    U771_11785
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U771_11785
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U771_11785
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    U771_11785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psk04147]
    U771_11785
Enzymes [BR:psk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U771_11785
Exosome [BR:psk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U771_11785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHC34885
Position
2539126..2540367
Genome map
AA seq 413 aa AA seqDB search
MNRVGQYSAFADVAIFEAVRTPWVDLGGALSQVSPIDLGIKVGREVLARAGIDPLAVDSV
LAGSMAQASFDAYLLPRHIGLYSGVAQAVPALGVQRICATGFELLRQAAEQLRDEVQLAL
CVASESMSRNPIAAYTHRDGFRLGGEVQFKDFLWEALYDPAPGLDMIATADNLARRYGLS
REAVDRHACDSHQRALQAQRDGAWAEEIVTVDNQVFELEGYQPRGISLARWAGAVSVDSH
PRPTDLAALARLRTVHPDGVQTAGNSCAVVDGAAAALVGRASACTHPPLARLLASAVVGV
APEFMGIGPAPAIRLLLQRSGLNLGDIDRFEINEAQAAQVLAVAHELELDSTRLNVQGGS
LALGHPLAATGLRLVMTLARQLRQHNLRYGIASACVGGGQGMALLIENPTYRA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgcgtcgggcagtactcggcgtttgccgacgtggcgattttcgaggcagtgcgc
acgccatgggtggacctgggcggagcactgtcccaggtgtcgcccatcgaccttgggatc
aaggtcggccgtgaagtgctggcccgcgccggcatcgaccccttggcagtggacagcgta
ctggccggctccatggcccaggccagcttcgatgcctacttgctgccacggcatatcggc
ttgtacagcggtgtggcgcaagcggtcccggcactgggggtgcagcgcatctgcgccacc
ggtttcgagctgttgcgccaggccgctgaacaactgcgcgacgaggtgcaactggcgttg
tgcgtggccagtgagtccatgtcgcgcaacccgattgcggcctacacccaccgggatggg
tttcgtctcggtggcgaggtgcaattcaaggatttcctctgggaggccctgtacgacccg
gccccgggcctggacatgatcgccaccgccgacaacctggcgcgccgttatggcctgagc
cgcgaggccgtggaccgtcacgcctgcgacagccatcagcgtgccttgcaggcgcaacgt
gacggcgcctgggcggaagaaatcgtcacggtcgacaaccaggtgttcgagcttgagggg
taccagcccaggggcatcagcctcgcgcgctgggccggtgccgtcagcgtcgacagccac
ccacgacccaccgaccttgcggccctggcgcgcttgcgcaccgtgcatccagacggcgtg
caaaccgccggcaacagttgcgcggtggtcgatggcgcggcggcggcgctggtggggcgc
gcctcggcctgtacgcatccgcccctggcccggctgctggccagcgcggtggtcggtgtg
gcccccgagttcatgggcatcggcccggcaccggcgatccgcctgttgctgcaacgcagc
gggttgaacctgggcgacatcgaccgcttcgagatcaacgaagcccaggccgcccaagta
ctggcggtggcccatgaactggagctggacagcacccgcctcaacgtccagggcggctcg
cttgcgctggggcatccactggccgccaccggcctgcgcctggtgatgaccctggcccgg
caactgcgccagcacaacctgcgctacgggattgcctcggcgtgtgtgggcggcgggcag
ggcatggcgttgctgatcgagaaccctacctatcgcgcttga

DBGET integrated database retrieval system