KEGG   Pseudomonas sp. TKP: U771_12545Help
Entry
U771_12545        CDS       T02969                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00040  Pentose and glucuronate interconversions
psk00053  Ascorbate and aldarate metabolism
psk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    U771_12545
   00053 Ascorbate and aldarate metabolism
    U771_12545
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     U771_12545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHC35033
Position
2713934..2715514
Genome map
AA seq 526 aa AA seqDB search
MPQFLGHNYIGGQRSANGSVKLYSVDASTGEALPQAFYQATPEEVDAAAQAAAAAYPAYR
ALSAARRAQFLDAIADELDALSDNFIELVCRETALPAARIKGERGRTSGQMRLFATVLRR
GDFYGARIDKALPDRQPLPRPDLRQYRIGLGPVAVFGASNFPLAFSTAGGDTAAALAAGC
PVVFKAHSGHMATAEQVADAIMRAAAASEMPVGVFNMIFGGGVGEALVKHPAIQAVGFTG
SLKGGRALCDMAAARPQPIPVFAEMSSINPVIVLPQALQARAETVARDLTASVVQGCGQF
CTNPGLVIGIASPAFTAFTQQVAQLIGDQPAQTMLNAGTLGSYAKGLEKLLAHPGIQHLA
GSVQAGNQAQPQVFKADVRLLIDGDEVLQEEVFGPTTVFVEVADQAQLTAALHGLHGQLT
ATIIGEPADFQQFAELTPLLEQKVGRILLNGYPTGVEVCDAMVHGGPYPATSDARGTSVG
TLAIDRFLRPVCFQNYPDSLLPDALKNANPLRIQRLVDGTPSRDPL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgccccagttcctcggccacaactatatcggcggccagcgcagcgccaacggcagcgtc
aagctgtacagcgtcgatgccagcacgggcgaagccttgccgcaggctttctaccaggcc
acgccggaagaggtcgacgccgccgcccaggccgccgctgcggcttacccggcctaccgc
gccttgagtgccgcgcgccgcgcgcagttcctggacgcgatcgccgacgagctggatgcc
ctgagcgataatttcatcgagttggtctgccgcgaaaccgcgctgcccgccgcacgtatc
aaaggcgagcgtgggcgcaccagcggccagatgcgcctgttcgctacggtgctgcgccgg
ggtgatttctatggtgcccgtatcgacaaggcgttacccgatcgccagccgctgccacgc
ccggacctgcgccaataccgcatcggcctgggcccggtcgccgtgtttggcgcgagcaac
tttcccctggccttttccacggcgggcggcgacaccgctgccgcactggcggccggctgc
ccggtggtgttcaaggcccacagcgggcacatggccacggcggaacaggtggccgatgcg
atcatgcgcgcggctgcggccagcgaaatgccggtgggtgtgttcaatatgattttcggc
ggcggcgttggtgaagcgctggtcaagcacccggcgatccaggcagtgggctttaccggc
tcgctcaagggtggccgcgccttgtgcgacatggcggcggcgcgcccgcagccgatcccg
gtgtttgccgagatgtcgagcatcaacccggtgattgtgttgccccaggcgttgcaggcc
agggccgaaaccgtcgcccgcgacctgaccgcctcggtggtgcaaggctgcggccagttc
tgcaccaaccccggcctggtgatcggtatcgcgtcgccggcgttcactgcgttcacccag
caggtggcgcaattgatcggcgatcaacccgcccaaaccatgctcaatgccggcaccctg
ggcagctatgccaagggcctggaaaaactcctggcgcaccctggcatccagcacctggcg
ggcagcgtccaggccggcaaccaggcgcagccgcaagtgttcaaggccgatgtacgcctg
ttgatcgacggcgacgaagtgttgcaggaggaagtcttcggcccgaccacggtgttcgtc
gaagtcgccgaccaggcccaactcactgccgccttgcacggcctgcacggccagctcacg
gcgacgatcattggcgaaccggcggactttcaacagttcgccgagctcacgccgctgctg
gaacagaaagtcgggcgcatcctgctcaacggctacccgaccggcgtggaagtctgcgat
gcgatggtccacggcgggccgtacccggcgacctccgacgcccgtggcacctcggtcggc
accttggccatcgaccgtttcctgcgcccggtgtgcttccagaactaccctgatagcctg
ctgcccgacgcgttgaaaaacgccaacccattgcgtatccagcgtctggtggatggcacg
ccatcgcgcgacccgctgtaa

KEGG   Pseudomonas sp. TKP: U771_17660Help
Entry
U771_17660        CDS       T02969                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00040  Pentose and glucuronate interconversions
psk00053  Ascorbate and aldarate metabolism
psk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    U771_17660
   00053 Ascorbate and aldarate metabolism
    U771_17660
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     U771_17660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHC36050
Position
3857615..3859186
Genome map
AA seq 523 aa AA seqDB search
MTLTGKMLIGRQPLCGTREAIRAINPATHTPMEPAYAGGERQQVEQACALAWAAFDSYRE
TTLADRATFLDTIAERIEALGDELIERASAETGLPRPRIQGERARTCGQLRTFARCVRAG
EWLDVRVDTAQPERQPMARPDLRQRHIPLGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHGAHPGTSELVGRAVAQAVNDCGLPEGVFSLLYGSGHEVGITLVSDPRIKAVGFT
GSRSGGMALTQAAQARPEPIPVYAEMSSINPVYLFPAALHARGEALAQGFVASLTQGAGQ
FCTNPGLVIAVQGAALDRFVNRVSELLPRSPAQTMLTAGIFSAYAEGVEALTRHARLVAQ
GQAAQGPNQGQAHLFLASADAFLGNAHLQAEVFGATSLVVACADEEQVRRVSEHLEGQLT
ATLHLDEDDLVPARTLLPVLERKAGRLLVNGWPTGVEVCDAMVHGGPFPATSDSRSTSVG
TAAILRFLRPVCYQDFPDSLLPTALQHSNPLLLRRLLDGQREA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactctgacgggcaagatgctgataggccggcaacccctttgcggcacgcgcgaggcg
atccgggccatcaaccccgctacccacacgccaatggagcccgcctacgccggcggtgaa
cgccaacaggttgagcaagcctgcgccctcgcctgggccgcgttcgacagctaccgcgaa
accaccctggccgatcgcgccacatttctcgacaccatcgccgagcgcatcgaggccctg
ggggacgaattgatcgaacgcgcgagcgccgaaaccggcctgccgcgcccgcgcatacag
ggcgaacgcgcgcgcacctgcgggcagctgcgcacgtttgcgcgctgcgtccgtgccggg
gaatggctggacgtacgcgtagacacggcacagcctgagcgccagccaatggcccgcccc
gacctgcgtcagcgccacatcccactggggccggtcgcggtgtttggcgcgagcaatttc
cccctggccttctctgtcgcgggcggcgacaccgcgtcggcactggccgccggttgcccg
gtgatcgtcaaggcccatggcgcccaccccggcaccagtgagctggtcggccgcgcggtt
gcccaggcggttaacgactgcggcctgcccgagggcgtgttttccttgctgtacggctcc
ggtcacgaggtcgggatcacgctggtgagcgacccgcgcatcaaagccgtaggcttcacc
ggttcgcgcagtggcggtatggcgctgacccaggcagcgcaggcacggccggaaccgatt
ccggtgtatgcggaaatgagttcgatcaacccggtgtacctgtttcctgccgcgctgcac
gcccggggcgaggccttggcacaggggtttgttgcgtcgctgacccagggggcgggccag
ttttgtaccaaccccggcctggtgattgcggttcaaggtgccgccctggaccgcttcgtc
aaccgggtcagcgagctactgccgcgcagcccggcccagaccatgctcactgcggggatt
ttcagtgcctatgcagagggcgtcgaggcattgacccgtcacgcccggctcgtcgcgcag
ggccaggcggcgcaaggtccgaatcaaggccaggcccatctgttcctggcctcggccgac
gcgttcctgggcaacgcccatttgcaggccgaagtcttcggcgccacttcgctggtggtg
gcgtgcgccgatgaggagcaagtacgccgggtatccgaacacctcgaaggccaactcacc
gcgaccctgcacctggatgaagacgacctggtgcctgcacgcacgctgctgccggtattg
gagcgcaaggccggtcgcctgctggtcaacggctggccgacgggggtcgaagtgtgcgac
gccatggtccatggcggccccttccccgccacctcggactcgcgcagcacctcggtgggc
acagcggcaatcctgcgattcctgcgcccggtgtgctaccaggatttcccggacagcttg
ctgccgaccgcactccagcacagcaacccgctgctgttgcggcgcctgctcgacggccag
agagaggcgtag

DBGET integrated database retrieval system