KEGG   Pseudomonas sp. TKP: U771_15485Help
Entry
U771_15485        CDS       T02969                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00450  Selenocompound metabolism
psk00970  Aminoacyl-tRNA biosynthesis
psk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    U771_15485
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    U771_15485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psk01007]
    U771_15485
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psk03016]
    U771_15485
Enzymes [BR:psk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     U771_15485
Amino acid related enzymes [BR:psk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   U771_15485
Transfer RNA biogenesis [BR:psk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    U771_15485
 Prokaryotic type
   Other AARSs
    U771_15485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AHC35620
Position
3362021..3363643
Genome map
AA seq 540 aa AA seqDB search
MTAITAQKFFLMPIPPTPNGRLHLGHIAGPYLRMDMLGRYLRTQGHSVDVVSAVDGFDSY
VLWKGVQEQREPEEVVRDYHGQIANDLRALDVEVDDFLDLVQGPYAAQHADNARRTVERL
VALGVTETVVERVLYCPHTRRYMAGAWLVGQCPYCQAGAGGYFCEACGALFRPETMLNPQ
PRMGDSPLQWVEVESLFLKVAHPDQLLRRMAASGAPASIIEVIARFLERENGRVRLTAPG
DWGVAWSPDRFDNPRVLFESGWEYALTCADRAREHSPEHGHAMLRSSEVTTLVSFGIDNA
VLLLAGSVAVMDALQDHQSFDYVLTNYFYNLQGAKFSTSRLHVVWAADIVEKTPATSDGV
RYFLCRESPELGETNFAVEEFVEVVNVDLAGALDRRVDLALGSLDQARLQSIEPDLLPGL
EMAVARLGQAFRLDAVSVRDAWEVLHQWMQRPDLDVTQPGHAYLWLKGLAYLAAPIMPRL
AEHLWHRLGHDGLPVVQALYAASLPRPETVVRPRFAALSPLALAPCLPASVVLAGASSDA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgactgctatcaccgcgcaaaaattcttcctgatgccgattcctcccacgcccaacggc
aggttgcacctgggccacattgccggtccttacttgcgcatggacatgctcgggcgctac
ctgcgcacccaggggcacagtgtcgatgtggtctcggcggtagacggcttcgactcctac
gtcctgtggaaaggcgtgcaggagcagcgcgagcccgaagaggtggtgcgtgactaccac
gggcagatcgccaacgacctgcgcgcgctggatgtcgaggtcgatgacttcctcgacctg
gtgcaaggcccgtacgccgcgcagcatgcagacaatgcccggcgcacggtcgagcgcctg
gtggcgttgggcgtgaccgaaaccgtggtcgaacgtgtgctgtattgcccgcatacccgt
cgctacatggccggcgcgtggctggtggggcagtgcccgtattgccaggccggggctggc
ggctacttctgtgaagcctgcggtgccttgttccgcccggaaaccatgctcaatccccag
ccgcgcatgggcgacagcccgttgcagtgggtcgaggtcgaaagtttgttcctgaaagtg
gcccaccccgaccagttgctgcggcgcatggcggcgtccggtgcgccggcgtcgatcatc
gaggtgatcgcgcgcttcttggaacgcgaaaatggccgcgtgcggctgactgcacccggc
gactggggcgtggcctggagcccggatcgttttgacaacccacgcgtgttgttcgagtcc
ggctgggaatacgcactgacctgcgccgaccgtgcccgcgagcactccccggagcacggc
cacgccatgctgcgcagcagcgaggtgaccacgctggtcagctttggtatcgataacgcg
gtgttgctgctggcgggcagcgtggcggtgatggatgccctgcaggatcaccagtcgttt
gactacgtgctgaccaactacttctacaacctgcaaggcgcgaagttttccaccagccgc
ctgcatgtggtctgggccgccgatatcgtcgaaaaaaccccggccaccagcgatggcgtg
cgttatttcctctgccgcgaaagccccgaactgggcgaaaccaatttcgccgtggaggag
tttgtcgaggtggtcaatgtggacctggccggtgccctcgaccggcgtgtcgacctggcc
ctcggcagcctcgatcaggcccggttgcagtccatcgagccagacttgttgccgggcctc
gaaatggccgttgcgcgcctgggccaggcgttccggctcgacgctgtatcggtgcgcgac
gcctgggaggtgttgcaccagtggatgcaacggccggacctggacgtgacacagcctggg
cacgcttacttgtggctcaagggcctggcgtacctggccgcgccgatcatgccgcgcctg
gccgagcacctgtggcaccgcctgggccatgacggtttgccggtggtccaggcgctgtat
gccgcctcgctgccgaggccggagaccgtggtgcgcccgcgctttgcggccttgtccccg
ctggcgctggcgccatgcttgccggccagcgtggtgctggcgggtgcatccagcgatgca
tga

DBGET integrated database retrieval system