KEGG   Pseudomonas sp. TKP: U771_20825Help
Entry
U771_20825        CDS       T02969                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00053  Ascorbate and aldarate metabolism
psk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    U771_20825
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     U771_20825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind NAD_binding_10 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AHC36670
Position
4593410..4594228
Genome map
AA seq 272 aa AA seqDB search
MTTTTPTPFNRLLLTGAAGGLGKVLRERLRPYAQVLRLSDIANMAPAADASEEVQPCDLA
DKQAVHHLVEGVDAILHFGGVSVERSFEEVLGANISGIFHIYEAARRHGVKRVVFASSNH
VIGFYKQGEQLDAHSPRRPDSYYGLSKSYGEDMASFYFDRYGIETVSIRIGSSFPEPQNR
RMMHTWLSFDDLTQLLERALYTPNVGHTVVYGMSANLDTWWDNRYAAHLGYAPKDTSEVF
RAQVETQPPVAADDPAKVYQGGAFCAAGPFGD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgactacccccactcccttcaaccgcctgctgctcaccggtgccgccggcggc
ctcggtaaagtcctgcgcgaacgcctgcgcccttacgcccaagtacttcgcctgtcggac
attgccaacatggccccggcggccgacgccagcgaagaagtgcaaccctgcgacctcgcc
gacaaacaagccgtgcatcacctggtggaaggcgtcgacgccatcctgcattttggcggt
gtctcggtcgaacgctccttcgaagaagtgctaggcgccaatatcagcggcatcttccac
atctacgaagccgcgcgccgccatggcgtcaagcgcgtggtcttcgccagctccaatcat
gtgatcggcttctacaagcagggcgaacagctcgacgcccactccccacgccgcccagac
agctactacggcttgtccaagtcctatggcgaagacatggccagtttctacttcgaccgc
tacggcatcgagaccgtcagtatccgtatcggctcttcgttcccggaaccgcagaaccgc
cggatgatgcacacctggctgagcttcgacgacctgacccaactgctcgaacgcgcgctg
tatacgccgaacgtcggccacaccgtggtctacggcatgtcggctaacctcgacacctgg
tgggacaaccgctacgccgcgcacctgggctatgccccgaaagacacctccgaagtcttc
cgtgcccaggtcgaaacccagccccccgtagcggccgatgacccggccaaggtgtatcaa
ggcggggcattctgcgccgctggaccgttcggtgactga

DBGET integrated database retrieval system