KEGG   Pseudomonas sp. TKP: U771_21550Help
Entry
U771_21550        CDS       T02969                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psk  Pseudomonas sp. TKP
Pathway
psk00010  Glycolysis / Gluconeogenesis
psk00053  Ascorbate and aldarate metabolism
psk00071  Fatty acid degradation
psk00280  Valine, leucine and isoleucine degradation
psk00310  Lysine degradation
psk00330  Arginine and proline metabolism
psk00340  Histidine metabolism
psk00380  Tryptophan metabolism
psk00410  beta-Alanine metabolism
psk00561  Glycerolipid metabolism
psk00620  Pyruvate metabolism
psk00625  Chloroalkane and chloroalkene degradation
psk00903  Limonene and pinene degradation
psk01100  Metabolic pathways
psk01110  Biosynthesis of secondary metabolites
psk01120  Microbial metabolism in diverse environments
psk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    U771_21550
   00053 Ascorbate and aldarate metabolism
    U771_21550
   00620 Pyruvate metabolism
    U771_21550
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U771_21550
   00561 Glycerolipid metabolism
    U771_21550
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U771_21550
   00310 Lysine degradation
    U771_21550
   00330 Arginine and proline metabolism
    U771_21550
   00340 Histidine metabolism
    U771_21550
   00380 Tryptophan metabolism
    U771_21550
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    U771_21550
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    U771_21550
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    U771_21550
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     U771_21550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AHC36815
Position
4753750..4755228
Genome map
AA seq 492 aa AA seqDB search
MTTPILAAYAINGDQYINGTWRAGGSTRRLDDRNPFNGEPLLEMPLASVADLDDAYQAAQ
RAQTDWAALHPTERGAQLEKLAQVIQNRREEIIDWLICESGSTRIKAGMEWQFTLNLVRE
CTTLPMQVEGRILTSYKPGEQSFVFREPLGVVGVISPWNFPLYLSMRSVVPALALGNTVV
LKPASDTAVTGGLLIAHLFEEAGFPAGSLNVVVGAGSEIGDAFVEHPIPSLISFTGSTDV
GRNVGRIATGGKHIKRVALELGGNAPLVVLEDADIEIAAHAAVVGRFLHQGQICMSVNRV
IVDRSLYADFAALVVERVRNLKTGDPAQADTVIGPVVNQSQLDGLLGKIAAAERAGLKQL
CGGQARGLVLPAHVFGEVGPDQALARDETFGPLLPLMIAQNQAHALELANASEYGLSSAV
FTRDMARGLNFARGIVAGMTHINDITVDDQPNAPFGGEKNSGLGRFNGHYALDEFTRAHW
VTWQAGSHHYPF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacaactccaatactcgcggcctacgccatcaacggcgaccaatacatcaacggcacc
tggcgcgccggtggttcgacacgacgcctggacgaccgcaaccccttcaacggcgaaccc
ttgctggaaatgcccctggcctcggtggccgacctggatgacgcctaccaggccgcccag
cgcgcacagaccgactgggccgcgctgcacccgaccgagcgcggcgcacagctggaaaag
ctcgcccaggtcatccagaaccgccgcgaagaaatcatcgactggctgatctgtgagtcc
ggcagtacccgcatcaaggcgggcatggagtggcagttcaccctcaacctggttcgcgag
tgcaccaccctaccgatgcaggttgaggggcggatcctgaccagctacaagcctggtgag
cagagcttcgtgtttcgcgaaccactgggggtggtcggtgtgatcagcccgtggaacttc
ccgctgtacctgagcatgcgttccgtggtgccggcacttgcgctgggcaataccgtggta
ctcaagccggccagcgacacggcagtgaccggcggcctgctgattgcccacctgttcgaa
gaagccgggttccccgccggttcgctgaacgtggtggtcggcgcgggttcggagattggc
gatgccttcgtcgaacacccgataccgagcctgatctctttcaccggttccaccgatgtg
ggacgcaatgtcggacgcatcgccaccggtggcaagcacatcaagcgggtggcgctggag
ctgggcggcaacgcgccgctggtggtgctggaggatgcggacatcgagatcgcggcgcat
gccgccgtggtcgggcgcttcctgcatcagggccagatttgcatgagcgtcaaccgggtc
attgtggatcgctcgctgtatgccgatttcgcagcgctggtggtcgagcgcgtgcgcaat
ctcaagaccggtgacccggcccaggccgatacggtgatcgggccggtggtcaaccaaagt
cagctcgacggtctgctggggaagatcgccgccgccgagcgcgccggtctcaagcagttg
tgtggcggccaggcgcgcgggctggtgctgccggcccatgtctttggcgaagtgggcccc
gaccaggccctggctcgcgatgaaaccttcgggccgttgctgccgttgatgatcgcgcaa
aaccaggcccatgccctggagttggccaacgccagcgagtacggtctgtccagtgcggtg
tttacccgcgacatggcgcgcggcctgaactttgcccgtggcatcgtggcgggtatgacc
catatcaacgacatcacggtcgatgatcagcccaatgcgccgttcggcggcgaaaagaac
tccggccttggccgcttcaatggtcactatgccttggatgaattcacccgggcccattgg
gtgacctggcaagccgggagccatcactacccgttctga

DBGET integrated database retrieval system