KEGG   Pseudomonas sp. TKP: U771_31080
Entry
U771_31080        CDS       T02969                                 

Definition
(GenBank) type VI secretion system protein ImpM
  KO
K11890  type VI secretion system protein ImpM
Organism
psk  Pseudomonas sp. TKP
Pathway
psk02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    U771_31080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psk02044]
    U771_31080
Secretion system [BR:psk02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   U771_31080
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: AHC38680
Position
complement(6792321..6792974)
AA seq 217 aa
MTTLGFYGKLASRGDFVSRALPQSFIGPWDSWLAAGLLASQQSLGAEWLNVYLVSPLWRF
VLAPGVCGPNAAAGVVMPSIDRVGRYFPLAVVALLDHDTNPASLVGGPDTWFEQAEELLL
GTLDADATFERFNDGLDSLGLPAIEPRAVDSRFAGLQRVAATEPHQRMTALAEQACDGAS
LWWGRGSQTISPGLLRCQGLPATGDFAQFLLGQEGVM
NT seq 654 nt   +upstreamnt  +downstreamnt
atgacgacgctgggtttctacggcaagttggccagtcgtggggactttgtcagccgcgcc
ttgccccagagctttattggcccatgggacagctggttggcggcgggtttgctcgccagc
cagcagagcctgggcgccgagtggctcaacgtgtacctggtcagcccgctgtggcgcttt
gtgttggcgccgggtgtgtgcggaccgaacgcggcggcgggcgtggtgatgccgagcatc
gatcgggtggggcggtatttcccgctggcggtggtggccttgctcgatcacgacaccaac
ccggcttctctggtgggcggtccggacacctggttcgaacaggccgaagagctgttgctc
ggcaccctcgacgccgacgctacctttgaacgcttcaacgatggcctcgacagcttgggc
ttgccggcgattgagccgcgagcggtcgacagccgtttcgccggcctgcaacgtgtggcc
gccaccgagccccaccagcgcatgaccgcgctcgccgaacaggcctgcgacggtgccagc
ctgtggtggggccgtggttcgcagacgatttcccctggtttattgcggtgtcagggcctg
cccgccaccggcgattttgcgcagtttttgctcggacaagagggtgtgatgtag

DBGET integrated database retrieval system