KEGG   Pirellula staleyi: Psta_0329Help
Entry
Psta_0329         CDS       T01147                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
psl  Pirellula staleyi
Pathway
psl00010  Glycolysis / Gluconeogenesis
psl00030  Pentose phosphate pathway
psl00051  Fructose and mannose metabolism
psl00052  Galactose metabolism
psl00680  Methane metabolism
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01120  Microbial metabolism in diverse environments
psl01130  Biosynthesis of antibiotics
psl01200  Carbon metabolism
psl01230  Biosynthesis of amino acids
psl03018  RNA degradation
Module
psl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psta_0329
   00030 Pentose phosphate pathway
    Psta_0329
   00051 Fructose and mannose metabolism
    Psta_0329
   00052 Galactose metabolism
    Psta_0329
  Energy metabolism
   00680 Methane metabolism
    Psta_0329
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Psta_0329
Enzymes [BR:psl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Psta_0329
Protein phosphatases and associated proteins [BR:psl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Psta_0329
Messenger RNA biogenesis [BR:psl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Psta_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat SIS_2
Motif
Other DBs
NCBI-ProteinID: ADB15019
UniProt: D2R2B0
Position
complement(428902..430227)
Genome map
AA seq 441 aa AA seqDB search
MSHVATTFHDIAVDSLGTAEFPSPIRRARKPGENLCTFVSPEARIREFVEFSLVHPPAEE
RLFESAGPREHLFFRPALTRCAVVTCGGLCPGLNNVIRSLFLELHFNYGVAVVLGIPYGY
QGLDPSMGHAPIVLTPDSVLNIHHQGGTMLASSRGERDPEVMLNFLLQQRVDVLFCVGGD
GTQRGAHAIAMKAKERGAKLAVVGIPKTIDNDLSFCDRTFGLVTAVEKAVEALDCAHVEA
QGAPRGIGLVRLMGRDAGFIACNATLASQDVNYCLIPECPFELDGPRGLLEALRSRIDGR
GHAVIAVAEGAGQHLFGASSGTHDASGNRRFQDIGVYLKDRITTFFRERNRPVELKYIDP
SYMIRSAPANCDDMLLCDQLARHAAHAAMAGKTDVLICYKNGKFLHVPIPMAVAKKQQVE
LDGPLWASVLAATGQSARYGE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcacgtggctacaacgtttcacgacatcgctgtcgattcgctcggtaccgcagag
tttccatcgccgattcgtcgcgctcgcaagccgggcgagaatctgtgcacttttgtctcg
cctgaagcccgcattcgcgagttcgtcgagttctcgctcgtccatccgccggccgaagag
cgtctgtttgagtcggctggtccacgcgagcaccttttctttcggccagcactcacccgc
tgtgcggtggtcacttgtggcggactctgcccgggccttaacaacgtgattcggagtttg
ttcctcgaactccacttcaactacggtgtggccgtggtgctgggcattccgtatggctat
caagggctcgacccgtcgatggggcacgcgccgattgttttaacgcccgacagcgttctt
aatatccatcatcaaggtggcacgatgctcgccagcagtcgcggcgagcgcgatcctgag
gtgatgctcaacttcttgcttcagcagcgcgtggatgtgctgttttgtgtcggtggcgat
ggcacccagcgtggcgctcatgcgattgctatgaaagcgaaagagcgtggcgcgaagctc
gccgtcgtcggaattcccaaaacgatcgacaacgatctttcgttttgcgatcgaacgttt
ggacttgtaactgcggtggaaaaagcggtcgaggcgctcgactgtgcacatgtcgaagcg
caaggtgcgccgcgcggcataggactcgtacgtctcatgggacgcgatgccggtttcatc
gcctgcaatgccacgctcgccagtcaagacgtcaactattgcctcattcccgagtgtccc
tttgaactcgatggcccgcggggtttgctcgaggcgctccgctcgcgcatcgatggtcgt
ggtcacgcggtgatcgccgtcgcggaaggggcagggcagcatttgttcggcgcctcgtcc
ggtactcacgacgcgtcaggcaatcgtcgctttcaagatatcggcgtctacttgaaggat
cgcatcacgactttctttagggaacggaatcgtccggtcgagctaaagtacatcgacccc
agttacatgattcgtagtgcgccggctaattgcgacgatatgctgctgtgcgatcaactc
gcgcgacacgccgctcatgcggccatggctggcaagaccgacgtgctgatctgctacaaa
aacggcaagttcttgcacgtccccattccgatggcggttgccaaaaaacagcaagtagaa
ctcgacggtccgctgtgggccagtgtgctggccgccaccggccaaagcgcacgttacggc
gaataa

DBGET integrated database retrieval system