KEGG   Pirellula staleyi: Psta_1825Help
Entry
Psta_1825         CDS       T01147                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
psl  Pirellula staleyi
Pathway
psl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psta_1825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psl02044]
    Psta_1825
Secretion system [BR:psl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psta_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ADB16499
UniProt: D2QZL6
Position
complement(2315567..2316199)
Genome map
AA seq 210 aa AA seqDB search
MTPKFAHAVDPIMLHILSVLDRIAREEKLSPQDERLRIRTLIDQAEAILGSSPDWQLAKY
AICSWADEMLVDAPWEGRDWWSNNVLEVELFSTRTCYEQFYERAKEASSLTSRDALEVYY
VCVVLGFRGVYRDPELAIYSIQNLGLPPDIESWAKQASMSVRLGQGRPNMNGKRREISGA
PPQRGRMILLWSGLTMILIAATSAVYLFYG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccaagtttgcccatgccgtcgacccgatcatgctccacatcttgtcggtgctc
gatcggattgcgcgcgaggaaaaactctccccgcaagatgagcgactgcgcattcgcaca
ctcatcgatcaggccgaagcgattctcggcagttcgcccgactggcagctcgccaagtat
gccatttgctcgtgggccgacgaaatgctggtcgatgctccgtgggaggggcgcgattgg
tggagcaacaacgtgctcgaagtcgaactcttcagcactcgtacctgctacgaacagttc
tacgagcgggcgaaagaggcatcgtcactcacgtcgcgtgatgcgctggaagtttactac
gtttgtgtcgtcctcggctttcgcggcgtctatcgcgatcccgaactagcgatctactcg
atccagaatctgggactccctcccgacatcgaaagttgggccaagcaggcctcgatgtcg
gtgcgacttggccaaggtcgccccaacatgaatgggaagcgtcgcgagatcagcggtgct
ccaccccagcgcggtcgcatgatcttgctgtggtcgggactcaccatgatcctcattgca
gccacttcagccgtgtatctgttttacggataa

DBGET integrated database retrieval system